Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_054345104.1
FASTA Graphics
LOCUS XM_054345104 894 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens CKLF like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant X1, mRNA. ACCESSION XM_054345104 VERSION XM_054345104.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060927) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..894 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="3" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..894 /gene="CMTM7" /gene_synonym="CKLFSF7" /note="CKLF like MARVEL transmembrane domain containing 7; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 21 ESTs, 2 long SRA reads, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns" /db_xref="GeneID:112616" /db_xref="HGNC:HGNC:19178" /db_xref="MIM:607890" CDS 55..510 /gene="CMTM7" /gene_synonym="CKLFSF7" /codon_start=1 /product="CKLF-like MARVEL transmembrane domain-containing protein 7 isoform X1" /protein_id="XP_054201079.1" /db_xref="GeneID:112616" /db_xref="HGNC:HGNC:19178" /db_xref="MIM:607890" /translation="MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTH AALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRV LTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGADNQSPLA" ORIGIN 1 atctggcccc tgggcagctg cccggggagg cggccagcga gctggggccg cgcaatgtcg 61 cacggagccg ggctcgtccg caccacgtgc agcagcggca gcgcgctcgg acccggggcc 121 ggcgcggccc agcccagcgc gagccccttg gaggggctgc tggacctcag ctacccccgc 181 acccacgcgg ccctgctgaa agtggcgcaa atggtcaccc tgctgattgc cttcatctgt 241 gtgcggagct ccctgtggac caactacagc gcctacagct actttgaagt ggtcaccatt 301 tgcgacttga taatgatcct cgccttttac ctggtccacc tcttccgctt ctaccgcgtg 361 ctcacctgta tcagctggcc cctgtcggaa cttctgcact atttaatcgg taccctgctc 421 ctcctcatcg cctccattgt ggcagcttcc aagagttaca accagagcgg actggtagcc 481 ggagcggata atcaaagtcc attggcttag ccccagcttg cttgtaaatg taaacccaga 541 ccaggcactg aagctgccaa gagtgaagac cgagaggcct ggctgccagc cctgacctgg 601 cccaacctgg gggactgggg ccagtggctg ggcctcgcgg ggcttcctct ctgcacctga 661 tccaggatga ggtggttggg ttagatgact ctccaagctc ctttctggcc agagacatga 721 agggaacaag cacagagatg agaagcagac aggattgccc gagtaattag ccctatggcc 781 tgtgaacttc ctctcccctc tctccactgc agatctttgg tttcatggcc accttcctct 841 gcatggcaag catatggctg tcctataaga tctcgtgtgt aacccagtcc acag //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
SNP
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on