U.S. flag

An official website of the United States government

PREDICTED: Homo sapiens CKLF like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant X1, mRNA

NCBI Reference Sequence: XM_054345104.1

FASTA Graphics 

LOCUS       XM_054345104             894 bp    mRNA    linear   PRI 26-AUG-2024
DEFINITION  PREDICTED: Homo sapiens CKLF like MARVEL transmembrane domain
            containing 7 (CMTM7), transcript variant X1, mRNA.
ACCESSION   XM_054345104
VERSION     XM_054345104.1
DBLINK      BioProject: PRJNA807723
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060927) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_009914755.1-RS_2024_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/23/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..894
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="CHM13"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /sex="female"
                     /cell_line="CHM13htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..894
                     /gene="CMTM7"
                     /gene_synonym="CKLFSF7"
                     /note="CKLF like MARVEL transmembrane domain containing 7;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 21 ESTs, 2 long SRA reads, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 27 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:112616"
                     /db_xref="HGNC:HGNC:19178"
                     /db_xref="MIM:607890"
     CDS             55..510
                     /gene="CMTM7"
                     /gene_synonym="CKLFSF7"
                     /codon_start=1
                     /product="CKLF-like MARVEL transmembrane domain-containing
                     protein 7 isoform X1"
                     /protein_id="XP_054201079.1"
                     /db_xref="GeneID:112616"
                     /db_xref="HGNC:HGNC:19178"
                     /db_xref="MIM:607890"
                     /translation="MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTH
                     AALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRV
                     LTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGADNQSPLA"
ORIGIN      
        1 atctggcccc tgggcagctg cccggggagg cggccagcga gctggggccg cgcaatgtcg
       61 cacggagccg ggctcgtccg caccacgtgc agcagcggca gcgcgctcgg acccggggcc
      121 ggcgcggccc agcccagcgc gagccccttg gaggggctgc tggacctcag ctacccccgc
      181 acccacgcgg ccctgctgaa agtggcgcaa atggtcaccc tgctgattgc cttcatctgt
      241 gtgcggagct ccctgtggac caactacagc gcctacagct actttgaagt ggtcaccatt
      301 tgcgacttga taatgatcct cgccttttac ctggtccacc tcttccgctt ctaccgcgtg
      361 ctcacctgta tcagctggcc cctgtcggaa cttctgcact atttaatcgg taccctgctc
      421 ctcctcatcg cctccattgt ggcagcttcc aagagttaca accagagcgg actggtagcc
      481 ggagcggata atcaaagtcc attggcttag ccccagcttg cttgtaaatg taaacccaga
      541 ccaggcactg aagctgccaa gagtgaagac cgagaggcct ggctgccagc cctgacctgg
      601 cccaacctgg gggactgggg ccagtggctg ggcctcgcgg ggcttcctct ctgcacctga
      661 tccaggatga ggtggttggg ttagatgact ctccaagctc ctttctggcc agagacatga
      721 agggaacaag cacagagatg agaagcagac aggattgccc gagtaattag ccctatggcc
      781 tgtgaacttc ctctcccctc tctccactgc agatctttgg tttcatggcc accttcctct
      841 gcatggcaag catatggctg tcctataaga tctcgtgtgt aacccagtcc acag
//
55..510
/gene="CMTM7"
/gene_synonym="CKLFSF7"
/codon_start=1
/product="CKLF-like MARVEL transmembrane domain-containing
protein 7 isoform X1"
/protein_id="XP_054201079.1"
/db_xref="GeneID:112616"
/db_xref="HGNC:HGNC:19178"
/db_xref="MIM:607890"
/translation="MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTH
AALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRV
LTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGADNQSPLA"
Feature XM_054345104 : 1 segment
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq alternative splicing
    See 3 reference mRNA sequence splice variants for the CMTM7 gene.
  • RefSeq protein product
    See the reference protein sequence for CKLF-like MARVEL transmembrane domain-containing protein 7 isoform X1 (XP_054201079.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.