Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_QTMO01000098.1
FASTA Graphics
LOCUS NZ_QTMO01000098 1156 bp DNA linear CON 08-JAN-2025 DEFINITION Bacteroides sp. AF16-7 AF16-7.Scaf98, whole genome shotgun sequence. ACCESSION NZ_QTMO01000098 NZ_QTMO01000000 VERSION NZ_QTMO01000098.1 DBLINK BioProject: PRJNA224116 BioSample: SAMN09734319 Assembly: GCF_003603315.1 KEYWORDS WGS; RefSeq. SOURCE Bacteroides sp. AF16-7 ORGANISM Bacteroides sp. AF16-7 Bacteria; Pseudomonadati; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides. REFERENCE 1 (bases 1 to 1156) AUTHORS Zou,Y., Xue,W. and Luo,G. TITLE A genome reference for cultivated species of the human gut microbiota JOURNAL Unpublished REFERENCE 2 (bases 1 to 1156) AUTHORS Zou,Y., Xue,W. and Luo,G. TITLE Direct Submission JOURNAL Submitted (01-AUG-2018) BGI-CNGB, BGI, No. 11, Beishan IZ., Yantian Dist., Shenzhen, Guangdong 518083, China COMMENT REFSEQ INFORMATION: The reference sequence is identical to QTMO01000098.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: SOAPdenovo v. 2 Genome Representation :: Full Expected Final Version :: Yes Genome Coverage :: 100x Sequencing Technology :: Illumina Hiseq ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_003603315.1-RS_2025_01_08 Annotation Date :: 01/08/2025 18:19:37 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.9 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 4,385 CDSs (total) :: 4,317 Genes (coding) :: 4,230 CDSs (with protein) :: 4,230 Genes (RNA) :: 68 rRNAs :: 2, 1, 1 (5S, 16S, 23S) complete rRNAs :: 2, 1, 1 (5S, 16S, 23S) tRNAs :: 61 ncRNAs :: 3 Pseudo Genes (total) :: 87 CDSs (without protein) :: 87 Pseudo Genes (ambiguous residues) :: 0 of 87 Pseudo Genes (frameshifted) :: 13 of 87 Pseudo Genes (incomplete) :: 75 of 87 Pseudo Genes (internal stop) :: 9 of 87 Pseudo Genes (multiple problems) :: 9 of 87 CRISPR Arrays :: 2 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1156 /organism="Bacteroides sp. AF16-7" /mol_type="genomic DNA" /submitter_seqid="AF16-7.Scaf98" /strain="AF16-7" /isolation_source="feces" /host="Homo sapiens" /db_xref="taxon:2292918" /geo_loc_name="China: Shenzhen" /collection_date="2013-10-01" gene <1..>247 /locus_tag="DWW72_RS22435" /old_locus_tag="DWW72_22440" /pseudo CDS <1..>247 /locus_tag="DWW72_RS22435" /old_locus_tag="DWW72_22440" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_004293559.1" /note="incomplete; too short partial abutting assembly gap; missing N-terminus and C-terminus; Derived by automated computational analysis using gene prediction method: Protein Homology." /pseudo /codon_start=1 /transl_table=11 /product="hypothetical protein" gene <427..>1156 /locus_tag="DWW72_RS22440" /old_locus_tag="DWW72_22445" CDS <427..>1156 /locus_tag="DWW72_RS22440" /old_locus_tag="DWW72_22445" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_004322853.1" /GO_function="GO:0003824 - catalytic activity [Evidence IEA]" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=3 /transl_table=11 /product="PHP domain-containing protein" /protein_id="WP_120164353.1" /translation="DGDKLVFNLMESPDVLMEEGIFHVAFPFGRNWYYYDLREEFRFN LLKYIGRPKPPVHDVPFVNLGIHTSYELLNACCSPEDLCRKAKWLGHTAVGICDRNTM AATLNLQKECANTGLKHIFGYSLTMTHEEERVGLKIYALDNEGLHNLLRIQRAVMVDS EDNTLRYEQLLMYAAGCVVVFAIRSVYWMAGHPKQVKRIRKGAEAVYYQVDANEYKAD RIDREQLEALKYYFGNCYDADTDS" CONTIG join(QTMO01000098.1:1..1156) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on