U.S. flag

An official website of the United States government

Bacteroides sp. AF16-7 AF16-7.Scaf98, whole genome shotgun sequence

NCBI Reference Sequence: NZ_QTMO01000098.1

FASTA Graphics 

LOCUS       NZ_QTMO01000098         1156 bp    DNA     linear   CON 08-JAN-2025
DEFINITION  Bacteroides sp. AF16-7 AF16-7.Scaf98, whole genome shotgun
            sequence.
ACCESSION   NZ_QTMO01000098 NZ_QTMO01000000
VERSION     NZ_QTMO01000098.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN09734319
            Assembly: GCF_003603315.1
KEYWORDS    WGS; RefSeq.
SOURCE      Bacteroides sp. AF16-7
  ORGANISM  Bacteroides sp. AF16-7
            Bacteria; Pseudomonadati; Bacteroidota; Bacteroidia; Bacteroidales;
            Bacteroidaceae; Bacteroides.
REFERENCE   1  (bases 1 to 1156)
  AUTHORS   Zou,Y., Xue,W. and Luo,G.
  TITLE     A genome reference for cultivated species of the human gut
            microbiota
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1156)
  AUTHORS   Zou,Y., Xue,W. and Luo,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2018) BGI-CNGB, BGI, No. 11, Beishan IZ., Yantian
            Dist., Shenzhen, Guangdong 518083, China
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            QTMO01000098.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: SOAPdenovo v. 2
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100x
            Sequencing Technology  :: Illumina Hiseq
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_003603315.1-RS_2025_01_08
            Annotation Date                   :: 01/08/2025 18:19:37
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.9
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 4,385
            CDSs (total)                      :: 4,317
            Genes (coding)                    :: 4,230
            CDSs (with protein)               :: 4,230
            Genes (RNA)                       :: 68
            rRNAs                             :: 2, 1, 1 (5S, 16S, 23S)
            complete rRNAs                    :: 2, 1, 1 (5S, 16S, 23S)
            tRNAs                             :: 61
            ncRNAs                            :: 3
            Pseudo Genes (total)              :: 87
            CDSs (without protein)            :: 87
            Pseudo Genes (ambiguous residues) :: 0 of 87
            Pseudo Genes (frameshifted)       :: 13 of 87
            Pseudo Genes (incomplete)         :: 75 of 87
            Pseudo Genes (internal stop)      :: 9 of 87
            Pseudo Genes (multiple problems)  :: 9 of 87
            CRISPR Arrays                     :: 2
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1156
                     /organism="Bacteroides sp. AF16-7"
                     /mol_type="genomic DNA"
                     /submitter_seqid="AF16-7.Scaf98"
                     /strain="AF16-7"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:2292918"
                     /geo_loc_name="China: Shenzhen"
                     /collection_date="2013-10-01"
     gene            <1..>247
                     /locus_tag="DWW72_RS22435"
                     /old_locus_tag="DWW72_22440"
                     /pseudo
     CDS             <1..>247
                     /locus_tag="DWW72_RS22435"
                     /old_locus_tag="DWW72_22440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004293559.1"
                     /note="incomplete; too short partial abutting assembly
                     gap; missing N-terminus and C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            <427..>1156
                     /locus_tag="DWW72_RS22440"
                     /old_locus_tag="DWW72_22445"
     CDS             <427..>1156
                     /locus_tag="DWW72_RS22440"
                     /old_locus_tag="DWW72_22445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004322853.1"
                     /GO_function="GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=3
                     /transl_table=11
                     /product="PHP domain-containing protein"
                     /protein_id="WP_120164353.1"
                     /translation="DGDKLVFNLMESPDVLMEEGIFHVAFPFGRNWYYYDLREEFRFN
                     LLKYIGRPKPPVHDVPFVNLGIHTSYELLNACCSPEDLCRKAKWLGHTAVGICDRNTM
                     AATLNLQKECANTGLKHIFGYSLTMTHEEERVGLKIYALDNEGLHNLLRIQRAVMVDS
                     EDNTLRYEQLLMYAAGCVVVFAIRSVYWMAGHPKQVKRIRKGAEAVYYQVDANEYKAD
                     RIDREQLEALKYYFGNCYDADTDS"
CONTIG      join(QTMO01000098.1:1..1156)
//
<1..>247
/locus_tag="DWW72_RS22435"
/old_locus_tag="DWW72_22440"
/inference="COORDINATES: similar to AA
sequence:RefSeq:WP_004293559.1"
/note="incomplete; too short partial abutting assembly
gap; missing N-terminus and C-terminus; Derived by
automated computational analysis using gene prediction
method: Protein Homology."
/pseudo
/codon_start=1
/transl_table=11
/product="hypothetical protein"
Warning: Cannot highlight feature because no sequence is shown. Show the sequence
Feature NZ_QTMO01000098 : 1 segment
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.