U.S. flag

An official website of the United States government

Escherichia coli ATCC 25922 contig0140, whole genome shotgun sequence

NCBI Reference Sequence: NZ_LRDO01000140.1

FASTA Graphics 

LOCUS       NZ_LRDO01000140          626 bp    DNA     linear   CON 18-JUN-2024
DEFINITION  Escherichia coli ATCC 25922 contig0140, whole genome shotgun
            sequence.
ACCESSION   NZ_LRDO01000140 NZ_LRDO01000000
VERSION     NZ_LRDO01000140.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN04419578
            Assembly: GCF_004151095.1
KEYWORDS    WGS; RefSeq.
SOURCE      Escherichia coli ATCC 25922
  ORGANISM  Escherichia coli ATCC 25922
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Enterobacterales; Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 626)
  AUTHORS   Gram,L. and Franzyk,H.
  TITLE     Adaptive laboratory evolution of Escherichia coli to antimicrobial
            peptides (AMPs) and peptidomimetics
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 626)
  AUTHORS   Citterio,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JAN-2016) Systems Biology, Technical University of
            Denmark, Matematiktorvet, Kongens Lyngby 2800, Denmark
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            LRDO01000140.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: CLC NGS Cell v. January 2016
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 80.0x
            Sequencing Technology  :: Illumina NextSeq 500
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_004151095.1-RS_2024_06_18
            Annotation Date                   :: 06/18/2024 04:21:46
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.7
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 5,039
            CDSs (total)                      :: 4,980
            Genes (coding)                    :: 4,731
            CDSs (with protein)               :: 4,731
            Genes (RNA)                       :: 59
            rRNAs                             :: 1, 1, 1 (5S, 16S, 23S)
            complete rRNAs                    :: 1, 1, 1 (5S, 16S, 23S)
            tRNAs                             :: 50
            ncRNAs                            :: 6
            Pseudo Genes (total)              :: 249
            CDSs (without protein)            :: 249
            Pseudo Genes (ambiguous residues) :: 0 of 249
            Pseudo Genes (frameshifted)       :: 93 of 249
            Pseudo Genes (incomplete)         :: 170 of 249
            Pseudo Genes (internal stop)      :: 53 of 249
            Pseudo Genes (multiple problems)  :: 56 of 249
            Pseudo Genes (short protein)      :: 2 of 249
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..626
                     /organism="Escherichia coli ATCC 25922"
                     /mol_type="genomic DNA"
                     /submitter_seqid="contig0140"
                     /strain="ATCC 25922"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:25922"
                     /db_xref="taxon:1322345"
     gene            <1..171
                     /locus_tag="AWM77_RS25745"
                     /old_locus_tag="AWM77_25410"
                     /pseudo
     CDS             <1..171
                     /locus_tag="AWM77_RS25745"
                     /old_locus_tag="AWM77_25410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_310828.1"
                     /note="incomplete; too short partial abutting assembly
                     gap; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF945 domain-containing protein"
     gene            226..>626
                     /locus_tag="AWM77_RS25455"
                     /old_locus_tag="AWM77_25415"
     CDS             226..>626
                     /locus_tag="AWM77_RS25455"
                     /old_locus_tag="AWM77_25415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein"
                     /protein_id="WP_129789269.1"
                     /translation="MKTISHNSTTSSVSVTAASGNDQPQLVATIVPDEQRISFWPQHF
                     GLIPQWVTLEPRVFGWMDRLCEDYCGGIWNLYTLNNGGAFMAPEPDDDDDETWVLFNA
                     MNGNHAEMSPEAAGIAACLMTYSHHACRTEC"
CONTIG      join(LRDO01000140.1:1..626)
//
<1..171
/locus_tag="AWM77_RS25745"
/old_locus_tag="AWM77_25410"
/inference="COORDINATES: similar to AA
sequence:RefSeq:NP_310828.1"
/note="incomplete; too short partial abutting assembly
gap; missing N-terminus; Derived by automated
computational analysis using gene prediction method:
Protein Homology."
/pseudo
/codon_start=1
/transl_table=11
/product="DUF945 domain-containing protein"
Warning: Cannot highlight feature because no sequence is shown. Show the sequence
Feature NZ_LRDO01000140 : 1 segment
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.