Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_LRDO01000140.1
FASTA Graphics
LOCUS NZ_LRDO01000140 626 bp DNA linear CON 18-JUN-2024 DEFINITION Escherichia coli ATCC 25922 contig0140, whole genome shotgun sequence. ACCESSION NZ_LRDO01000140 NZ_LRDO01000000 VERSION NZ_LRDO01000140.1 DBLINK BioProject: PRJNA224116 BioSample: SAMN04419578 Assembly: GCF_004151095.1 KEYWORDS WGS; RefSeq. SOURCE Escherichia coli ATCC 25922 ORGANISM Escherichia coli ATCC 25922 Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 626) AUTHORS Gram,L. and Franzyk,H. TITLE Adaptive laboratory evolution of Escherichia coli to antimicrobial peptides (AMPs) and peptidomimetics JOURNAL Unpublished REFERENCE 2 (bases 1 to 626) AUTHORS Citterio,L. TITLE Direct Submission JOURNAL Submitted (18-JAN-2016) Systems Biology, Technical University of Denmark, Matematiktorvet, Kongens Lyngby 2800, Denmark COMMENT REFSEQ INFORMATION: The reference sequence is identical to LRDO01000140.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: CLC NGS Cell v. January 2016 Genome Representation :: Full Expected Final Version :: Yes Genome Coverage :: 80.0x Sequencing Technology :: Illumina NextSeq 500 ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_004151095.1-RS_2024_06_18 Annotation Date :: 06/18/2024 04:21:46 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.7 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 5,039 CDSs (total) :: 4,980 Genes (coding) :: 4,731 CDSs (with protein) :: 4,731 Genes (RNA) :: 59 rRNAs :: 1, 1, 1 (5S, 16S, 23S) complete rRNAs :: 1, 1, 1 (5S, 16S, 23S) tRNAs :: 50 ncRNAs :: 6 Pseudo Genes (total) :: 249 CDSs (without protein) :: 249 Pseudo Genes (ambiguous residues) :: 0 of 249 Pseudo Genes (frameshifted) :: 93 of 249 Pseudo Genes (incomplete) :: 170 of 249 Pseudo Genes (internal stop) :: 53 of 249 Pseudo Genes (multiple problems) :: 56 of 249 Pseudo Genes (short protein) :: 2 of 249 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..626 /organism="Escherichia coli ATCC 25922" /mol_type="genomic DNA" /submitter_seqid="contig0140" /strain="ATCC 25922" /host="Homo sapiens" /culture_collection="ATCC:25922" /db_xref="taxon:1322345" gene <1..171 /locus_tag="AWM77_RS25745" /old_locus_tag="AWM77_25410" /pseudo CDS <1..171 /locus_tag="AWM77_RS25745" /old_locus_tag="AWM77_25410" /inference="COORDINATES: similar to AA sequence:RefSeq:NP_310828.1" /note="incomplete; too short partial abutting assembly gap; missing N-terminus; Derived by automated computational analysis using gene prediction method: Protein Homology." /pseudo /codon_start=1 /transl_table=11 /product="DUF945 domain-containing protein" gene 226..>626 /locus_tag="AWM77_RS25455" /old_locus_tag="AWM77_25415" CDS 226..>626 /locus_tag="AWM77_RS25455" /old_locus_tag="AWM77_25415" /inference="COORDINATES: similar to AA sequence:RefSeq:NP_309429.1" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="antirestriction protein" /protein_id="WP_129789269.1" /translation="MKTISHNSTTSSVSVTAASGNDQPQLVATIVPDEQRISFWPQHF GLIPQWVTLEPRVFGWMDRLCEDYCGGIWNLYTLNNGGAFMAPEPDDDDDETWVLFNA MNGNHAEMSPEAAGIAACLMTYSHHACRTEC" CONTIG join(LRDO01000140.1:1..626) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on