U.S. flag

An official website of the United States government

Nakamurella endophytica strain CGMCC 4.7308 sequence30, whole genome shotgun sequence

NCBI Reference Sequence: NZ_BMNA01000030.1

FASTA Graphics 

LOCUS       NZ_BMNA01000030          525 bp    DNA     linear   CON 02-SEP-2024
DEFINITION  Nakamurella endophytica strain CGMCC 4.7308 sequence30, whole
            genome shotgun sequence.
ACCESSION   NZ_BMNA01000030 NZ_BMNA01000000
VERSION     NZ_BMNA01000030.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMD00245197
            Assembly: GCF_014646215.1
KEYWORDS    WGS; RefSeq; STANDARD_DRAFT.
SOURCE      Nakamurella endophytica
  ORGANISM  Nakamurella endophytica
            Bacteria; Bacillati; Actinomycetota; Actinomycetes; Nakamurellales;
            Nakamurellaceae; Nakamurella.
REFERENCE   1
  AUTHORS   Wu,L. and Ma,J.
  TITLE     The Global Catalogue of Microorganisms (GCM) 10K type strain
            sequencing project: providing services to taxonomists for standard
            genome sequencing and annotation
  JOURNAL   Int J Syst Evol Microbiol 69 (4), 895-898 (2019)
   PUBMED   30832757
REFERENCE   2  (bases 1 to 525)
  AUTHORS   Sun,Q. and Zhou,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2020) Contact:Qinglan Sun Institute of
            Microbiology, Chinese Academy of Sciences, WFCC-MIRCEN World Data
            Centre for Microorganisms (WDCM); No. 3, yard 1, Beichen W Rd, Ao
            Yun Cun, Chaoyang, Beijing, Beijing 1000101, China URL
            :http://www.wdcm.org/
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            BMNA01000030.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: gcType assembly pipeline
            Genome Coverage       :: 100X
            Sequencing Technology :: Illumina HiSeq X Ten
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_014646215.1-RS_2024_09_02
            Annotation Date                   :: 09/02/2024 04:12:38
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.8
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 4,369
            CDSs (total)                      :: 4,317
            Genes (coding)                    :: 4,269
            CDSs (with protein)               :: 4,269
            Genes (RNA)                       :: 52
            rRNAs                             :: 1, 1, 1 (5S, 16S, 23S)
            complete rRNAs                    :: 1, 1, 1 (5S, 16S, 23S)
            tRNAs                             :: 46
            ncRNAs                            :: 3
            Pseudo Genes (total)              :: 48
            CDSs (without protein)            :: 48
            Pseudo Genes (ambiguous residues) :: 0 of 48
            Pseudo Genes (frameshifted)       :: 12 of 48
            Pseudo Genes (incomplete)         :: 39 of 48
            Pseudo Genes (internal stop)      :: 0 of 48
            Pseudo Genes (multiple problems)  :: 3 of 48
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..525
                     /organism="Nakamurella endophytica"
                     /mol_type="genomic DNA"
                     /submitter_seqid="sequence30"
                     /strain="CGMCC 4.7308"
                     /culture_collection="CGMCC:4.7308"
                     /type_material="type strain of Nakamurella endophytica"
                     /db_xref="taxon:1748367"
     gene            complement(<1..464)
                     /locus_tag="IEY37_RS21735"
     CDS             complement(<1..464)
                     /locus_tag="IEY37_RS21735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009778347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_188945036.1"
                     /translation="MSHANAALTPRHRLRLARAVVEDGWTIGYAAAVFNVSWPTAKRW
                     ADRYRQGGPAAMADRSSRPHRCPRRTPRPVIRKIVHLRWKQRLGPVPIADRLGLAAST
                     VHAVLVRCRLNRLSHIDRVTGEPIRRYEHDRPGALLHVDVKKLGNIPDGGGWR"
CONTIG      join(BMNA01000030.1:1..525)
//
complement(<1..464)
/locus_tag="IEY37_RS21735"
/inference="COORDINATES: similar to AA
sequence:RefSeq:WP_009778347.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="helix-turn-helix domain-containing protein"
/protein_id="WP_188945036.1"
/translation="MSHANAALTPRHRLRLARAVVEDGWTIGYAAAVFNVSWPTAKRW
ADRYRQGGPAAMADRSSRPHRCPRRTPRPVIRKIVHLRWKQRLGPVPIADRLGLAAST
VHAVLVRCRLNRLSHIDRVTGEPIRRYEHDRPGALLHVDVKKLGNIPDGGGWR"
Warning: Cannot highlight feature because no sequence is shown. Show the sequence
Feature NZ_BMNA01000030 : 1 segment (minus strand)
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.