U.S. flag

An official website of the United States government

Arabidopsis thaliana uncharacterized protein (AT1G02320), partial mRNA

NCBI Reference Sequence: NM_100113.1

FASTA Graphics 

LOCUS       NM_100113                147 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana uncharacterized protein (AT1G02320), partial
            mRNA.
ACCESSION   NM_100113
VERSION     NM_100113.1
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 147)
  AUTHORS   Theologis,A., Ecker,J.R., Palm,C.J., Federspiel,N.A., Kaul,S.,
            White,O., Alonso,J., Altafi,H., Araujo,R., Bowman,C.L.,
            Brooks,S.Y., Buehler,E., Chan,A., Chao,Q., Chen,H., Cheuk,R.F.,
            Chin,C.W., Chung,M.K., Conn,L., Conway,A.B., Conway,A.R.,
            Creasy,T.H., Dewar,K., Dunn,P., Etgu,P., Feldblyum,T.V., Feng,J.,
            Fong,B., Fujii,C.Y., Gill,J.E., Goldsmith,A.D., Haas,B.,
            Hansen,N.F., Hughes,B., Huizar,L., Hunter,J.L., Jenkins,J.,
            Johnson-Hopson,C., Khan,S., Khaykin,E., Kim,C.J., Koo,H.L.,
            Kremenetskaia,I., Kurtz,D.B., Kwan,A., Lam,B., Langin-Hooper,S.,
            Lee,A., Lee,J.M., Lenz,C.A., Li,J.H., Li,Y., Lin,X., Liu,S.X.,
            Liu,Z.A., Luros,J.S., Maiti,R., Marziali,A., Militscher,J.,
            Miranda,M., Nguyen,M., Nierman,W.C., Osborne,B.I., Pai,G.,
            Peterson,J., Pham,P.K., Rizzo,M., Rooney,T., Rowley,D., Sakano,H.,
            Salzberg,S.L., Schwartz,J.R., Shinn,P., Southwick,A.M., Sun,H.,
            Tallon,L.J., Tambunga,G., Toriumi,M.J., Town,C.D., Utterback,T.,
            Van Aken,S., Vaysberg,M., Vysotskaia,V.S., Walker,M., Wu,D., Yu,G.,
            Fraser,C.M., Venter,J.C. and Davis,R.W.
  TITLE     Sequence and analysis of chromosome 1 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 816-820 (2000)
   PUBMED   11130712
REFERENCE   2  (bases 1 to 147)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 147)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-2017) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 147)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   5  (bases 1 to 147)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003070).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..147
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="1"
                     /ecotype="Columbia"
     gene            <1..>147
                     /locus_tag="AT1G02320"
                     /gene_synonym="T6A9.30"
                     /db_xref="Araport:AT1G02320"
                     /db_xref="GeneID:839425"
                     /db_xref="TAIR:AT1G02320"
     CDS             1..147
                     /locus_tag="AT1G02320"
                     /gene_synonym="T6A9.30"
                     /note="unknown protein; Has 0 Blast hits to 0 proteins in
                     0 species (source: NCBI BLink)."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_171734.1"
                     /db_xref="Araport:AT1G02320"
                     /db_xref="GeneID:839425"
                     /db_xref="TAIR:AT1G02320"
                     /translation="MFIFSKYGSKALTATNGKQCQETGDLIYLAKPFTYLNGQSLSIQ
                     NPNQ"
ORIGIN      
        1 atgtttatat tttccaagta tggatcaaag gctctaacag caacaaatgg gaaacaatgt
       61 caagaaactg gggacctaat ctatctggca aagcctttta cttaccttaa tggccaaagt
      121 ctttccattc aaaatccaaa ccagtaa
//
1..147
/locus_tag="AT1G02320"
/gene_synonym="T6A9.30"
/note="unknown protein; Has 0 Blast hits to 0 proteins in
0 species (source: NCBI BLink)."
/codon_start=1
/product="uncharacterized protein"
/protein_id="NP_171734.1"
/db_xref="Araport:AT1G02320"
/db_xref="GeneID:839425"
/db_xref="TAIR:AT1G02320"
/translation="MFIFSKYGSKALTATNGKQCQETGDLIYLAKPFTYLNGQSLSIQ
NPNQ"
Feature NM_100113 : 1 segment
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for uncharacterized protein AT1G02320 (NP_171734.1).

More about the AT1G02320 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.