Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: FB863272.1
FASTA Graphics
LOCUS FB863272 798 bp DNA linear PAT 07-JAN-2009 DEFINITION Sequence 82545 from Patent WO2008034648. ACCESSION FB863272 VERSION FB863272.1 KEYWORDS . SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 AUTHORS Puzio,P., Blau,A., Walk,T.B., Gipmans,M., Haake,V., Weig,A., Plesch,G. and Ebneth,M. TITLE Process for the production of a fine chemical JOURNAL Patent: WO 2008034648-A1 82545 27-MAR-2008; Metanomics GmbH (DE) FEATURES Location/Qualifiers source 1..798 /organism="Arabidopsis thaliana" /mol_type="unassigned DNA" /db_xref="taxon:3702" CDS 1..798 /note="unnamed protein product" /codon_start=1 /protein_id="CAW70444.1" /translation="MEFERYLGEGSFGSVSLFSYKRRCDVETLYAAVKTSDDAKSLYE EFQILSKFKGCSRIVQCYGSGVEQRLNDKGYVEYTIPMEYAAGGSLSDFMDRFNDKKL PDPMIRKFTRMLLEGLATIHRHGYVHCDLKPENILVFPGSVCDLKLKISDFGLSKRDG DTTWWHPLKSYAGTPIYMSPESISHGEIGKGLDLWSLGCVVLEMYTGKRPWWHTNYEL EDLMKCYEPLFPPNLPCDAKLFLMTCFAPEPDERKDALTLLRQSFFR" ORIGIN 1 atggagttcg aaaggtatct gggggaaggt tcgtttggat cggtgagcct tttcagttat 61 aaaagacgat gcgacgttga gactctctac gccgccgtga aaacctctga cgatgctaag 121 tctctctacg aagagtttca gattctgtct aaattcaagg gttgctcgag aatcgtccaa 181 tgctacggta gcggagtaga acagagactt aacgacaagg gttacgtaga gtacacgatt 241 cctatggagt acgcagccgg aggaagcttg agcgatttca tggaccgatt caacgacaaa 301 aaattgcctg atccgatgat cagaaagttt actcgtatgc ttctcgaggg tttagccaca 361 attcacagac acggctatgt tcactgcgat ctcaaacccg agaacatcct tgttttccct 421 ggttctgtct gcgatctcaa attgaagatt tctgattttg ggttgtcgaa aagagatgga 481 gacactacgt ggtggcatcc tcttaaatcg tatgcgggaa caccgatcta tatgtcgccg 541 gagtctatct ctcacgggga gatagggaaa ggacttgact tatggtcgtt gggatgtgtt 601 gtgttggaga tgtacactgg gaagagacca tggtggcata ctaactatga actagaagat 661 ctcatgaagt gttacgagcc attgtttccg cctaatcttc cttgtgatgc aaaactcttt 721 ctcatgacct gctttgcgcc tgaaccagat gagaggaaag acgcgttgac attgttgaga 781 caaagcttct ttcgttga //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on