Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AM050200.1
FASTA Graphics
LOCUS AM050200 389 bp DNA linear INV 07-DEC-2006 DEFINITION Drosophila melanogaster CG12780 gene, strain Netherlands line N16, exon 1. ACCESSION AM050200 VERSION AM050200.1 KEYWORDS CG12780 gene. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 AUTHORS Jiggins,F.M. and Kim,K.W. TITLE Contrasting evolutionary patterns in Drosophila immune receptors JOURNAL J. Mol. Evol. 63 (6), 769-780 (2006) PUBMED 17103056 REFERENCE 2 (bases 1 to 389) AUTHORS Kim,K.W. TITLE Direct Submission JOURNAL Submitted (14-JUL-2005) Kim K.W., Institute of Evolutionary Biology, University of Edinburgh, West Mains Rd., Edinburgh, EH9 3JT, UNITED KINGDOM FEATURES Location/Qualifiers source 1..389 /organism="Drosophila melanogaster" /mol_type="genomic DNA" /strain="Netherlands line N16" /db_xref="taxon:7227" /geo_loc_name="Netherlands" gene <61..>363 /gene="CG12780" mRNA <61..>363 /gene="CG12780" CDS 61..363 /gene="CG12780" /codon_start=1 /product="CG12780 protein" /protein_id="CAJ18884.1" /db_xref="UniProtKB/TrEMBL:A0ZWY4" /translation="MSGYQVPLARVTSSERRGFEVSIDDEPGISLFGFHGRLNEPIVD LGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYYWTTVRYNGRDYHRMNQSAGF" exon 61..363 /gene="CG12780" /number=1 ORIGIN 1 ctgatattat tgttcatata tgcaagtgaa ctgcgtgaaa acagattagt ttgcaatata 61 atgtccggtt atcaagtccc actagcccga gtaacttctt cagaacgacg gggtttcgaa 121 gtatctatag atgatgagcc gggaatttca ctgttcggat tccacggcag actaaacgaa 181 ccaattgttg atcttgggaa tcagacatgg gcggctgata tcattgggaa ggataaagat 241 ggccgatgga cgtacaccaa tcgggatgtg gagctaaagg acggagacgt actttactac 301 tggacaacag tgcggtataa tggccgagac tatcaccgga tgaaccagag tgccggcttc 361 taaaaaagat ggattcaaaa gaatattgt //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on