Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
NCBI Reference Sequence: WP_033648335.1
GenPept Identical Proteins Graphics
Download a prokaryotic data package including protein sequence and gene sequence for all annotated locations for this protein as a zip archive.
>WP_033648335.1 MULTISPECIES: VOC family protein [Serratia] MFDHVKFGVSDFALSKAFFLNALAPLGVKIVAEGEPGYGVELCHDRGNVSLCLFQTDEKPAHLHLAFAAS SREQVDAFYHAALNAGGKDNGAPGLRPNYHAHYYAAFVIGPDGHNIEAVCHNPMS
Whole sequence Selected region from: to:
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on