U.S. flag

An official website of the United States government

  • This record is a non-redundant protein sequence. Please read more here.

MULTISPECIES: cold shock-like protein CspD [Klebsiella/Raoultella group]

NCBI Reference Sequence: WP_004860015.1

GenPept Identical Proteins Graphics 

>WP_004860015.1 MULTISPECIES: cold shock-like protein CspD [Klebsiella/Raoultella group]
MEMGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQAVRFDVHQGPKGNHASVIVPVEAE
AAA

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Protein clusters for WP_004860015.1

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.