U.S. flag

An official website of the United States government

  • This record is a non-redundant protein sequence. Please read more here.

MULTISPECIES: macrodomain Ori organization protein MaoP [Salmonella]

NCBI Reference Sequence: WP_000840996.1

GenPept Identical Proteins Graphics 

>WP_000840996.1 MULTISPECIES: macrodomain Ori organization protein MaoP [Salmonella]
MAESFTTTNRYFDNKHYPRGFSRHGDFTIKEAQLLERHGHAFNDLDLGKREPVTEEEKLFVAVCRGEREP
VTDAERVWSKYMTRIKRPKRFHTLSGGKPQVEGAEDYTEADD

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Protein clusters for WP_000840996.1

More about the gene maoP

  • maoP gene
    Also Known As: A464_RS19080, A464_3957

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.