U.S. flag

An official website of the United States government

Adenine nucleotide alpha hydrolases-like superfamily protein [Arabidopsis thaliana]

NCBI Reference Sequence: NP_566198.1

GenPept Identical Proteins Graphics 

>NP_566198.1 Adenine nucleotide alpha hydrolases-like superfamily protein [Arabidopsis thaliana]
MGKARTVGVGMDYSPTSKLALRWAAENLLEDGDTVILIHVQPQNADHTRKILFEETGSPLIPLEEFREVN
LSKQYGLAYDPEVLDVLDTLSRAKKVKVVAKVYWGDPREKLCDAVENLKLDSIVLGSRGLGSLKRPNHNG
FMIIMFDHSLVGLVSLDHDQSGLINMAEMGSSKSICWIRRNQERDSRWSFSDLLLDDHPLD

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Reference sequence information

  • RefSeq mRNA
    See reference mRNA sequence for the AT3G03270 gene (NM_111197.3).
  • RefSeq protein isoforms
    See the other reference sequence protein isoform for the AT3G03270 gene (NP_850506.1).

More about the AT3G03270 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.