U.S. flag

An official website of the United States government

B12D protein [Arabidopsis thaliana]

NCBI Reference Sequence: NP_190397.1

GenPept Identical Proteins Graphics 

>NP_190397.1 B12D protein [Arabidopsis thaliana]
MASRWLRPEVYPLFAATGVAVGICAFSLIRNITGNPEVRCTKENRAAGILDNHAEGEKYKENFLRKFVRN
KKPEIMPGLNKFFTDPTY

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Protein clusters for NP_190397.1

  • B12D protein
    Total proteins: 2
    Total genera: 0
    Conserved in: Arabidopsis

More about the AT3G48140 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.