U.S. flag

An official website of the United States government

photosystem II subunit R [Arabidopsis thaliana]

NCBI Reference Sequence: NP_178025.1

GenPept Identical Proteins Graphics 

>NP_178025.1 photosystem II subunit R [Arabidopsis thaliana]
MAASVMLSSVTLKPAGFTVEKTAARGLPSLTRARPSFKIVASGVKKIKTDKPFGINGSMDLRDGVDASGR
KGKGYGVYKYVDKYGANVDGYSPIYNENEWSASGDVYKGGVTGLAIWAVTLAGILAGGALLVYNTSALAQ

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Protein clusters for NP_178025.1

Reference sequence information

  • RefSeq mRNA
    See reference mRNA sequence for the PSBR gene (NM_106555.4).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.