U.S. flag

An official website of the United States government

glial fibrillary acidic protein, partial [Homo sapiens]

GenBank: AAA52529.1

GenPept Identical Proteins Graphics 

>AAA52529.1 glial fibrillary acidic protein, partial [Homo sapiens]
LLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRD

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.