U.S. flag

An official website of the United States government

RecName: Full=Large ribosomal subunit protein eL8; AltName: Full=50S ribosomal protein L7Ae; AltName: Full=Ribosomal protein L8e

UniProtKB/Swiss-Prot: A9A2Z3.1

GenPept Identical Proteins Graphics 

>sp|A9A2Z3.1|RL7A_NITMS RecName: Full=Large ribosomal subunit protein eL8; AltName: Full=50S ribosomal protein L7Ae; AltName: Full=Ribosomal protein L8e
MGKAYYVKFETPEDLVNPILEAVRVASTSGKVKKGTNEATKAIERGTSKLIVIAEDVEPPEVVAHLPILC
EEQGAAFAFVPSKQELGKSLGIDITSAAAAILDAGDAQHIVDQVVSSIAKIKGGKTDQ

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Reference sequence information

  • RefSeq protein
    See the reference protein sequence for MULTISPECIES: 50S ribosomal protein L7Ae (WP_012214608.1).

More about the gene rpl7ae

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.