U.S. flag

An official website of the United States government

Homo sapiens arginine vasopressin induced 1 (AVPI1), mRNA

NCBI Reference Sequence: NM_021732.2

FASTA Graphics 

LOCUS       NM_021732               1422 bp    mRNA    linear   PRI 24-JUN-2018
DEFINITION  Homo sapiens arginine vasopressin induced 1 (AVPI1), mRNA.
ACCESSION   NM_021732
VERSION     NM_021732.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1422)
  AUTHORS   Yu H, Tardivo L, Tam S, Weiner E, Gebreab F, Fan C, Svrzikapa N,
            Hirozane-Kishikawa T, Rietman E, Yang X, Sahalie J, Salehi-Ashtiani
            K, Hao T, Cusick ME, Hill DE, Roth FP, Braun P and Vidal M.
  TITLE     Next-generation sequencing to generate interactome datasets
  JOURNAL   Nat. Methods 8 (6), 478-480 (2011)
   PUBMED   21516116
REFERENCE   2  (bases 1 to 1422)
  AUTHORS   Grupe A, Li Y, Rowland C, Nowotny P, Hinrichs AL, Smemo S, Kauwe
            JS, Maxwell TJ, Cherny S, Doil L, Tacey K, van Luchene R, Myers A,
            Wavrant-De Vrieze F, Kaleem M, Hollingworth P, Jehu L, Foy C,
            Archer N, Hamilton G, Holmans P, Morris CM, Catanese J, Sninsky J,
            White TJ, Powell J, Hardy J, O'Donovan M, Lovestone S, Jones L,
            Morris JC, Thal L, Owen M, Williams J and Goate A.
  TITLE     A scan of chromosome 10 identifies a novel locus showing strong
            association with late-onset Alzheimer disease
  JOURNAL   Am. J. Hum. Genet. 78 (1), 78-88 (2006)
   PUBMED   16385451
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   3  (bases 1 to 1422)
  AUTHORS   Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X,
            Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X,
            Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S and Gu J.
  TITLE     Large-scale cDNA transfection screening for genes related to cancer
            development and progression
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729 (2004)
   PUBMED   15498874
  REMARK    Erratum:[Proc Natl Acad Sci U S A. 2004 Dec 14:101(50):17565]
REFERENCE   4  (bases 1 to 1422)
  AUTHORS   Thomas CP, Loftus RW and Liu KZ.
  TITLE     AVP-induced VIT32 gene expression in collecting duct cells occurs
            via trans-activation of a CRE in the 5'-flanking region of the
            VIT32 gene
  JOURNAL   Am. J. Physiol. Renal Physiol. 287 (3), F460-F468 (2004)
   PUBMED   15140762
REFERENCE   5  (bases 1 to 1422)
  AUTHORS   Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L,
            Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE,
            Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles
            J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD,
            Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H,
            Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J,
            Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee
            CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner
            L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S,
            Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E,
            Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C,
            Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK,
            Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird
            G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE,
            McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson
            T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan
            S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou
            T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore
            N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J,
            Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead
            SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK,
            Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T,
            Doucette-Stamm L, Beck S, Smith DR and Rogers J.
  TITLE     The DNA sequence and comparative analysis of human chromosome 10
  JOURNAL   Nature 429 (6990), 375-381 (2004)
   PUBMED   15164054
REFERENCE   6  (bases 1 to 1422)
  AUTHORS   Nicod M, Michlig S, Flahaut M, Salinas M, Fowler Jaeger N,
            Horisberger JD, Rossier BC and Firsov D.
  TITLE     A novel vasopressin-induced transcript promotes MAP kinase
            activation and ENaC downregulation
  JOURNAL   EMBO J. 21 (19), 5109-5117 (2002)
   PUBMED   12356727
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AF131791.1.
            
            [WARNING] On Nov 23, 2018 this sequence was replaced by
            NM_021732.3.
            
            On Jun 12, 2008 this sequence version replaced NM_021732.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF131791.1, SRR1660805.300589.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03267753 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1422              AF131791.1         1-1422
FEATURES             Location/Qualifiers
     source          1..1422
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q24.2"
     gene            1..1422
                     /gene="AVPI1"
                     /gene_synonym="PP5395; VIP32; VIT32"
                     /note="arginine vasopressin induced 1"
                     /db_xref="GeneID:60370"
                     /db_xref="HGNC:HGNC:30898"
     exon            1..505
                     /gene="AVPI1"
                     /gene_synonym="PP5395; VIP32; VIT32"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    504..506
                     /gene="AVPI1"
                     /gene_synonym="PP5395; VIP32; VIT32"
                     /note="upstream in-frame stop codon"
     exon            506..802
                     /gene="AVPI1"
                     /gene_synonym="PP5395; VIP32; VIT32"
                     /inference="alignment:Splign:2.1.0"
     CDS             516..959
                     /gene="AVPI1"
                     /gene_synonym="PP5395; VIP32; VIT32"
                     /note="vasopressin-induced transcript; AVP-induced protein
                     1"
                     /codon_start=1
                     /product="arginine vasopressin-induced protein 1"
                     /protein_id="NP_068378.2"
                     /db_xref="CCDS:CCDS7470.1"
                     /db_xref="GeneID:60370"
                     /db_xref="HGNC:HGNC:30898"
                     /translation="MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQALFQ
                     RSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHS
                     ALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH"
     exon            803..1404
                     /gene="AVPI1"
                     /gene_synonym="PP5395; VIP32; VIT32"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
        1 ggctcgcctg ggagctcata cctggctagg gccgaggatt ggctgttccg gggctaggga
       61 gcgctttctc ccgggaaccg cggctgtgac ccaagtggcc cggaccagtt tggggctgcg
      121 tgcggcctgc ctcaagcaac caggtacgta ggtcggcggc ccagctcggc gctgcggtgg
      181 gagccggagg gcgacagtca gagccggggt gccagcggga cgcgaccgcc agatccactt
      241 aggaccccgt cgttctgcga agcggccacg tctgagtccc ggggcctcct cgtgctgcag
      301 atgtcgcctt aggacctcgg ccaggatacc ctctgccatg ctcttgtgct gcccgtgatc
      361 accgactggc ccttgtaagc accttcgcag caggaagccc agagctgcgc ctgccctttc
      421 tgaaggctgt ggaagaggtt ggagtgggcg catcttagct tgccccatcc ccatttgagg
      481 tctgtcggag ctgcccttca gtgtgagcat ccacaatggg taccccagcc tcggtggtca
      541 gtgagccacc cccttggcag gccccgattg aggcccgggg ccgcaagcag gcctcggcca
      601 acatcttcca ggacgccgag ctgctgcaga tccaagccct gtttcaacgc agcggggacc
      661 agctggccga ggaacgggca cagatcatct gggaatgtgc aggggaccac cgtgtggctg
      721 aggccctcaa gaggctgcgc aggaagaggc ccccaaggca gaaacccctg ggccactcgc
      781 tacaccactg cagccgcctc agaatcctgg agccccactc tgcactggcc aacccacaga
      841 gtgccacaga gacagcctcc agtgagcagt atctgcactc taggaagaaa agtgccagga
      901 tccgccggaa ctggaggaag tcaggcccca caagctacct ccaccagatc agacactgat
      961 ccagggaaag agccaggaat ggcagtgtct tccctcttgc caaaaggcct ggggaggtga
     1021 aggaagagag actttaggca agcagcccaa aggggtaaat gaaagcaaga ggctgctgcc
     1081 actgacctgc tccattcaga acaagactgg atgcttctgt tgagctctcc attatgtggg
     1141 acccattcct caccaaaatg aggagagaca gtgactgttc ctgccacagt ccttcccagt
     1201 ctaacactat tcctgggctg catgatattc ccctgggagc aaagtgacag gcacttagat
     1261 gcagcatttc accactcatg ctactaatca tctacctgct actactgtaa accatggttc
     1321 cagcagcctg ttccacaccc ccacaccatc aggatagcac agggaaactg tagtttaagt
     1381 ggcaaataaa aacatttgca tcaaaaaaaa aaaaaaaaaa aa
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.