Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_054378214.1
FASTA Graphics
LOCUS XM_054378214 1074 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens phospholipase C beta 2 (PLCB2), transcript variant X27, mRNA. ACCESSION XM_054378214 VERSION XM_054378214.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060939) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1074 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="15" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..1074 /gene="PLCB2" /gene_synonym="PLC-beta-2" /note="phospholipase C beta 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 ESTs, 33 long SRA reads, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns" /db_xref="GeneID:5330" /db_xref="HGNC:HGNC:9055" /db_xref="MIM:604114" CDS 264..911 /gene="PLCB2" /gene_synonym="PLC-beta-2" /codon_start=1 /product="1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X26" /protein_id="XP_054234189.1" /db_xref="GeneID:5330" /db_xref="HGNC:HGNC:9055" /db_xref="MIM:604114" /translation="MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKG YYLYWTYQSKEMEFLDITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVV SGPDMVDLTFHNFVSYKENVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLN SEGKIPVKNFFQMFPADRKRVEAALSACHLPKGKFRSCPSQWNSHCTKSGSEQTS" ORIGIN 1 agaagcagtg accacaggcc cccatggcag gcagggcggg tgggaggagg gtgatttaca 61 aggcagatgg gcctctggct acagctcagt cctgcactca gccagggcca ccccaggggc 121 tataagagca actagatttc tggagcagct cggggatggg tgccatttga gcccagcttg 181 gctccccctc ctggctggcc tccttcctgc ccttctgcct gcctgtgtct gctgagattc 241 tgcaaagagg aacgcttggc accatgtctc tgctcaaccc tgtcctgctg ccccccaagg 301 tgaaggccta tctgagccaa ggggagcgct tcatcaaatg ggatgatgaa actacagttg 361 cctctccagt tatcctccgt gtggatccta agggctacta cttatactgg acgtatcaaa 421 gtaaggagat ggagtttctg gatatcacca gcatccggga tactcgcttt gggaagtttg 481 ccaagatgcc caagagccag aagctccggg acgtcttcaa catggacttt cctgataaca 541 gtttcctgct gaagacactc acggtggtgt ccggcccgga catggtggac ctcaccttcc 601 acaacttcgt ctcctacaag gagaacgtgg gcaaggcctg ggctgaggac gtactggccc 661 tagtcaaaca tccgctgacg gccaacgcct cccgcagcac cttcctggac aagatccttg 721 tgaagctcaa gatgcagctc aactctgaag ggaagattcc ggtgaagaac tttttccaga 781 tgtttcctgc tgaccgcaag cgggtggaag ctgctctcag tgcctgccac ctccccaaag 841 gcaaattccg atcctgcccc agccaatgga atagccactg tacaaaatca gggtcagagc 901 aaaccagcta agcatgctct ctgctcagca accagggcct tgagaagtgg atgcttgggt 961 gtccttgaag ttcttctgtc tgccttgagc ccgccttctg accaggtccc cttgaccagg 1021 gctgggccga gtttgtggtt cttagctctg agaaggtgag ggcaggggca ataa //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
SNP
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on