Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_054351821.1
FASTA Graphics
LOCUS XM_054351821 1282 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens family with sequence similarity 81 member B (FAM81B), transcript variant X5, mRNA. ACCESSION XM_054351821 VERSION XM_054351821.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060929) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1282 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="5" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..1282 /gene="FAM81B" /note="family with sequence similarity 81 member B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 ESTs, 1 long SRA read, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:153643" /db_xref="HGNC:HGNC:26335" CDS 323..1123 /gene="FAM81B" /codon_start=1 /product="protein FAM81B isoform X5" /protein_id="XP_054207796.1" /db_xref="GeneID:153643" /db_xref="HGNC:HGNC:26335" /translation="MAFEKRNRSPGSYWKATSRPSPASSKNSAKILRCDSSIVKLSGD IHLFRQEHRQIEKAIQEFVPALETLSKNLDMKVMQLLGKIETASSEQTSNLKMVQGDY RHEMNLLEFKFHSLSSNLYEEVENNKKWTENQFLKYRKDHLGHINECLKVLQEKLEKS ENKMEEKLLQLSSKVENFINTQKQETQLSKVKHMENKLSKKMEQMEKQIWGELETMQN EYQSGFKSIHDSLSSLQQIQKTKMDLEKYKVQKDLKKLQRKIVELQEV" ORIGIN 1 tccagtgatc ttcacaacat aatttgctac cattcagagg cggcaacatg gaaaacatcc 61 taggctaagt tacaggtgac ctagagctaa tcctggctct accaaataaa tagttctgag 121 acattgaaac atttcttcaa ataaaaattc gtgcagaaat tcagtgtact aagcaggagt 181 catgcttttc tccccatcat tccaaacacc cagagaggtc agctagaaga cagactgaac 241 aaccaggcgc gtaccatagc tttccttctt gaacaagcct tccgcatcaa ggaggacatc 301 tctgcttgcc tgcaggggac ccatggcttt cgaaaagagg aatcgctcgc caggaagtta 361 ctggaaagcc acatccagac catcaccagc atcgtcaaaa aactcagcca aaatattgag 421 atgtgattca agcattgtga agctttctgg agacattcac ttattcaggc aagagcaccg 481 gcaaattgag aaagccattc aagaattcgt gcccgccctg gaaactcttt ccaagaactt 541 ggacatgaag gtgatgcagc tcttaggaaa gatagaaact gccagttctg agcaaacctc 601 gaatttaaag atggtccagg gggattatcg ccacgaaatg aaccttttgg aattcaaatt 661 tcattcactt tcaagtaatc tgtacgaaga agttgagaat aataaaaaat ggacagaaaa 721 ccaatttctc aaatatagaa aagaccacct gggccatata aatgaatgtc tgaaggtcct 781 acaggagaaa ctggaaaagt ctgaaaataa aatggaagaa aaactgctgc agctttcaag 841 caaagtagag aatttcatta acacacagaa acaggaaaca caactaagta aagtaaagca 901 tatggaaaat aaattgtcca aaaagatgga acaaatggaa aagcagatct ggggtgaatt 961 agagacaatg cagaatgaat atcaatcagg atttaaatca attcatgact ctctcagctc 1021 cctccaacaa atacagaaaa caaagatgga tttagagaaa tataaagtac agaaagacct 1081 aaagaaatta cagcgcaaga tagtggaact ccaggaagta taaacctttt cagtcatctt 1141 ctttttcatc agccaatgga gtgatttgtt ggaaaaagtt ctgaagaaga aagttactat 1201 ctctgggatg tttactgctt ctaatgtctc cttttaagga gacgaatgta ccagaaaaat 1261 aataaagcaa agaagctttg ga //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
SNP
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on