Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_028831826.1
FASTA Graphics
LOCUS XM_028831826 1273 bp mRNA linear PRI 26-APR-2019 DEFINITION PREDICTED: Macaca mulatta BRISC and BRCA1 A complex member 2 (BABAM2), transcript variant X14, mRNA. ACCESSION XM_028831826 VERSION XM_028831826.1 DBLINK BioProject: PRJNA528504 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_041766.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Macaca mulatta Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1273 /organism="Macaca mulatta" /mol_type="mRNA" /isolate="AG07107" /bio_material="Coriell:AG07107" /db_xref="taxon:9544" /chromosome="13" /sex="female" /tissue_type="fibroblast" gene 1..1273 /gene="BABAM2" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 145 ESTs, 3 long SRA reads, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns" /db_xref="GeneID:702365" CDS 161..1237 /gene="BABAM2" /codon_start=1 /product="BRISC and BRCA1-A complex member 2 isoform X9" /protein_id="XP_028687659.1" /db_xref="GeneID:702365" /translation="MSPEVALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGC TSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDVEFLPDPSALQNL ASWNPSNPECLLLVVKELVQQYHQFQCSRLRESSRLMFEYQTLLEEPQYGENMEIYAG KKNNWTGEFSARFLLKLPVDFSNIPTYLLKDVNEDPGEDVALLSVSFEDTEATQVYPK LYLSPRIEHSPSQRQSVMYACPSMNIQSALGGSSALHIPAFPGGGCLIDYVPQVCHLL TNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHSPGR LLLIGQLLAIIMHILDARGKRHFS" ORIGIN 1 ggggcggggc gggacgtccg gggagtgcgc acgcatccgg cccgcggcgc gcgcgcaggt 61 cggtgcgtcg gtcgggggcg cgctcgggta cctgtacccc acgtagtcgc cggttaccga 121 tcggactaag ttccagtggt gatttacaag tcaagttaaa atgtccccag aagtggcctt 181 gaaccgaata tctccaatgc tctcgccttt catatctagc gtggtccgga atggaaaagt 241 gggactggat gctacaaact gtttgaggat aactgactta aaatctggct gcacatcatt 301 gactcctggg cccaactgtg accgatttaa actgcacata ccatatgctg gagagacatt 361 aaaatgggat atcattttca atgcccaata cccagaactg cctcccgatt ttatctttgg 421 agaggatgtt gaattcctgc cagacccctc agctttgcag aatcttgcct cctggaatcc 481 ttcaaatcct gaatgtctct tacttgtggt gaaggaactt gtgcaacagt atcaccaatt 541 ccaatgcagc cgcctccggg agagctcccg cctcatgttt gaataccaga cattactgga 601 agagccacag tatggagaga acatggaaat ttatgctggg aaaaaaaaca actggactgg 661 tgaattttca gctcgtttcc ttttgaagtt gccagtggat ttcagcaata tccccacata 721 ccttctcaag gatgtaaatg aagaccctgg agaagatgtg gccctcctct ctgttagttt 781 tgaggacact gaagccaccc aggtgtaccc caagctgtac ttgtcacctc gaattgagca 841 ctccccttcc cagaggcagt cagttatgta tgcatgtcct tccatgaata tacaaagtgc 901 acttggaggc tcctcagctc ttcatatccc agctttccca ggaggaggat gtctcattga 961 ttacgttcct caagtatgcc acctgctcac caacaaggtg cagtatgtga ttcaagggta 1021 tcacaaaaga agagagtata ttgctgcttt cctcagtcac tttggcacag gtgtcgtgga 1081 atatgatgca gaaggcttta caaaactcac tctgctgctg atgtggaaag atttttgttt 1141 tcttgtacac agcccaggaa gattgctatt gataggacag ctcctggcaa taattatgca 1201 cattttggat gctagaggaa agaggcactt ctcttgagac agacagctct gacctcagac 1261 tttgccagag ttt //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on