Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_015115031.2
FASTA Graphics
LOCUS XM_015115031 1082 bp mRNA linear PRI 26-APR-2019 DEFINITION PREDICTED: Macaca mulatta ADP-ribosyltransferase 5 (ART5), transcript variant X9, mRNA. ACCESSION XM_015115031 VERSION XM_015115031.2 DBLINK BioProject: PRJNA528504 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_041767.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process On Apr 23, 2019 this sequence version replaced XM_015115031.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Macaca mulatta Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1082 /organism="Macaca mulatta" /mol_type="mRNA" /isolate="AG07107" /bio_material="Coriell:AG07107" /db_xref="taxon:9544" /chromosome="14" /sex="female" /tissue_type="fibroblast" gene 1..1082 /gene="ART5" /note="ADP-ribosyltransferase 5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 EST, 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:574238" CDS 207..1082 /gene="ART5" /codon_start=1 /product="ecto-ADP-ribosyltransferase 5 isoform X7" /protein_id="XP_014970517.2" /db_xref="GeneID:574238" /translation="MALASLMMALGCLGLHTWQAQAVPILPLGLAPDTFDDAYVGCAE EMEEKAAPLLKAEMAHHALLRESWEAAQEAWEDRHRGLTLPPGFKAQNGIAIMVYTNS SNTLYWKLNQAVRTGGGSRELYMRHFPFKALHFYLIRALQLLGGGGGCSTGPGEVVFR GVGSLRFEPKRLGDSVRLGQFASSSLDKAVACRFGNATLFSLTTCFGAPIQAFSVFPK EREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGAL GTGDLHMKKRRLQQP" ORIGIN 1 ctcccgcctc agcctcccaa agtgctagga ttacaggagt gagcaaccgc gccctgccct 61 ggagctgttt ttctaacaag cactcagaag cacctccctc cccaccctcc tccaagactg 121 gacccacgcc ggactccggg gacagcgcag cgcccgcccg agccctcggc gctacctcct 181 gctcgcggcc tccgcaacct tcagggatgg cactggcgtc actgatgatg gccctcggct 241 gccttggcct ccacacctgg caggcccagg ctgttcccat cctgcccctg ggactggctc 301 cagacacctt tgacgatgcc tatgtgggtt gtgcagagga gatggaggag aaggcagccc 361 ccctgctaaa ggcggaaatg gcccaccatg ccctgcttcg ggaatcctgg gaggcagccc 421 aggaggcctg ggaggacagg catcgagggc tcaccttacc ccctggcttc aaagcccaga 481 atggaatagc cattatggtc tacaccaact catctaacac cttgtactgg aagttgaatc 541 aggccgtgcg gacaggcgga ggctcccggg agctctacat gaggcacttt cccttcaagg 601 ccctgcattt ctacctgatc cgggccctgc agctgcttgg aggcggtggg ggctgcagca 661 cagggcctgg ggaggtggtg ttccgaggtg tgggcagcct tcgctttgaa cccaaaaggc 721 tgggggactc tgtccgctta ggccagtttg cctccagctc cctggataag gcagtggcct 781 gcagatttgg taatgccacc ctcttttctc taacgacttg ctttggggcc cctatccagg 841 ccttctctgt ctttcccaag gagcgcgagg tgctgattcc cccccatgaa gtcttcttgg 901 tcaccagatt ctctcaggat ggagcccaga gcctggtgac tctctggagc tataatcaga 961 cctgcagcca ctttaactgc gcctatctgg gtggggagaa gaggcggggc tgtgtgtctg 1021 caccaggagc cctgggaacg ggtgaccttc atatgaagaa gaggcgcctc caacagcctt 1081 ga //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on