U.S. flag

An official website of the United States government

PREDICTED: Macaca mulatta ADP-ribosyltransferase 5 (ART5), transcript variant X9, mRNA

NCBI Reference Sequence: XM_015115031.2

FASTA Graphics 

LOCUS       XM_015115031            1082 bp    mRNA    linear   PRI 26-APR-2019
DEFINITION  PREDICTED: Macaca mulatta ADP-ribosyltransferase 5 (ART5),
            transcript variant X9, mRNA.
ACCESSION   XM_015115031
VERSION     XM_015115031.2
DBLINK      BioProject: PRJNA528504
KEYWORDS    RefSeq.
SOURCE      Macaca mulatta (Rhesus monkey)
  ORGANISM  Macaca mulatta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_041767.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 23, 2019 this sequence version replaced XM_015115031.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Macaca mulatta Annotation Release
                                           103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1082
                     /organism="Macaca mulatta"
                     /mol_type="mRNA"
                     /isolate="AG07107"
                     /bio_material="Coriell:AG07107"
                     /db_xref="taxon:9544"
                     /chromosome="14"
                     /sex="female"
                     /tissue_type="fibroblast"
     gene            1..1082
                     /gene="ART5"
                     /note="ADP-ribosyltransferase 5; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     mRNA, 1 EST, 9 Proteins, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     17 samples with support for all annotated introns"
                     /db_xref="GeneID:574238"
     CDS             207..1082
                     /gene="ART5"
                     /codon_start=1
                     /product="ecto-ADP-ribosyltransferase 5 isoform X7"
                     /protein_id="XP_014970517.2"
                     /db_xref="GeneID:574238"
                     /translation="MALASLMMALGCLGLHTWQAQAVPILPLGLAPDTFDDAYVGCAE
                     EMEEKAAPLLKAEMAHHALLRESWEAAQEAWEDRHRGLTLPPGFKAQNGIAIMVYTNS
                     SNTLYWKLNQAVRTGGGSRELYMRHFPFKALHFYLIRALQLLGGGGGCSTGPGEVVFR
                     GVGSLRFEPKRLGDSVRLGQFASSSLDKAVACRFGNATLFSLTTCFGAPIQAFSVFPK
                     EREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGAL
                     GTGDLHMKKRRLQQP"
ORIGIN      
        1 ctcccgcctc agcctcccaa agtgctagga ttacaggagt gagcaaccgc gccctgccct
       61 ggagctgttt ttctaacaag cactcagaag cacctccctc cccaccctcc tccaagactg
      121 gacccacgcc ggactccggg gacagcgcag cgcccgcccg agccctcggc gctacctcct
      181 gctcgcggcc tccgcaacct tcagggatgg cactggcgtc actgatgatg gccctcggct
      241 gccttggcct ccacacctgg caggcccagg ctgttcccat cctgcccctg ggactggctc
      301 cagacacctt tgacgatgcc tatgtgggtt gtgcagagga gatggaggag aaggcagccc
      361 ccctgctaaa ggcggaaatg gcccaccatg ccctgcttcg ggaatcctgg gaggcagccc
      421 aggaggcctg ggaggacagg catcgagggc tcaccttacc ccctggcttc aaagcccaga
      481 atggaatagc cattatggtc tacaccaact catctaacac cttgtactgg aagttgaatc
      541 aggccgtgcg gacaggcgga ggctcccggg agctctacat gaggcacttt cccttcaagg
      601 ccctgcattt ctacctgatc cgggccctgc agctgcttgg aggcggtggg ggctgcagca
      661 cagggcctgg ggaggtggtg ttccgaggtg tgggcagcct tcgctttgaa cccaaaaggc
      721 tgggggactc tgtccgctta ggccagtttg cctccagctc cctggataag gcagtggcct
      781 gcagatttgg taatgccacc ctcttttctc taacgacttg ctttggggcc cctatccagg
      841 ccttctctgt ctttcccaag gagcgcgagg tgctgattcc cccccatgaa gtcttcttgg
      901 tcaccagatt ctctcaggat ggagcccaga gcctggtgac tctctggagc tataatcaga
      961 cctgcagcca ctttaactgc gcctatctgg gtggggagaa gaggcggggc tgtgtgtctg
     1021 caccaggagc cctgggaacg ggtgaccttc atatgaagaa gaggcgcctc caacagcctt
     1081 ga
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

More about the ART5 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.