U.S. flag

An official website of the United States government

PREDICTED: Macaca mulatta serine peptidase inhibitor, Kazal type 6 (SPINK6), transcript variant X1, mRNA

NCBI Reference Sequence: XM_001103616.4

FASTA Graphics 

LOCUS       XM_001103616             835 bp    mRNA    linear   PRI 26-APR-2019
DEFINITION  PREDICTED: Macaca mulatta serine peptidase inhibitor, Kazal type 6
            (SPINK6), transcript variant X1, mRNA.
ACCESSION   XM_001103616
VERSION     XM_001103616.4
DBLINK      BioProject: PRJNA528504
KEYWORDS    RefSeq.
SOURCE      Macaca mulatta (Rhesus monkey)
  ORGANISM  Macaca mulatta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_041759.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 23, 2019 this sequence version replaced XM_001103616.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Macaca mulatta Annotation Release
                                           103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..835
                     /organism="Macaca mulatta"
                     /mol_type="mRNA"
                     /isolate="AG07107"
                     /bio_material="Coriell:AG07107"
                     /db_xref="taxon:9544"
                     /chromosome="6"
                     /sex="female"
                     /tissue_type="fibroblast"
     gene            1..835
                     /gene="SPINK6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 mRNAs, 4 Proteins, and 42%
                     coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:709586"
     CDS             406..648
                     /gene="SPINK6"
                     /codon_start=1
                     /product="serine protease inhibitor Kazal-type 6"
                     /protein_id="XP_001103616.1"
                     /db_xref="GeneID:709586"
                     /translation="MKLSGIFLLLSLALFCFLSGVFSQGGRVDCGEFQDPKVYCTRES
                     NPHCGSDGQTYGNKCAFCKAMVKSGGKISLKHPGKC"
ORIGIN      
        1 ccattatcct gtggttactc acttggacca cagacatgaa ggacctgtct gcaagaaata
       61 gaagaatcaa gtggagctca accagtgaat catccccata atgtagggaa accttagaga
      121 ggagagccgg aaggatgtat gggttgttag gaaaatgtag gctaccagga gaaaatgaca
      181 tcctctgtta ataaaatctg aggtgcgact cacataattg tcccaatttt taagattgat
      241 ggggagcatg aagcacttat ttaaagtgtt gacaggcccc aataaatgca taaactgcat
      301 aggactcatg tggtctgaat gtattttagg gctttctggg aattgtcttg acagagaacc
      361 tgagctggac aaagcagcct tgatctgagt gagccaactg gcacaatgaa gctgtcaggt
      421 atctttctgc tcctctctct ggctcttttc tgctttttat caggtgtctt cagtcaggga
      481 ggacgggttg actgtggtga gttccaggac cccaaggtct actgcactcg ggaatcgaac
      541 ccacactgtg gctctgatgg ccagacatac ggcaataaat gtgccttctg taaggccatg
      601 gtgaaaagtg gtgggaagat tagcctaaag catcctggaa aatgctgagt aaaagccagt
      661 gtttcttggt gacttgccag ctcttgcggc cttcttttct cacttctgct tatacttttg
      721 ctagtggatt cttttaattc ataaagacat acccactctg cctgggtctt gaggagttga
      781 acgtatgtct atttctcttg attcacttgt aaataaagta cattctgcaa aagca
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.