Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_001103616.4
FASTA Graphics
LOCUS XM_001103616 835 bp mRNA linear PRI 26-APR-2019 DEFINITION PREDICTED: Macaca mulatta serine peptidase inhibitor, Kazal type 6 (SPINK6), transcript variant X1, mRNA. ACCESSION XM_001103616 VERSION XM_001103616.4 DBLINK BioProject: PRJNA528504 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_041759.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Apr 23, 2019 this sequence version replaced XM_001103616.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Macaca mulatta Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..835 /organism="Macaca mulatta" /mol_type="mRNA" /isolate="AG07107" /bio_material="Coriell:AG07107" /db_xref="taxon:9544" /chromosome="6" /sex="female" /tissue_type="fibroblast" gene 1..835 /gene="SPINK6" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 4 Proteins, and 42% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:709586" CDS 406..648 /gene="SPINK6" /codon_start=1 /product="serine protease inhibitor Kazal-type 6" /protein_id="XP_001103616.1" /db_xref="GeneID:709586" /translation="MKLSGIFLLLSLALFCFLSGVFSQGGRVDCGEFQDPKVYCTRES NPHCGSDGQTYGNKCAFCKAMVKSGGKISLKHPGKC" ORIGIN 1 ccattatcct gtggttactc acttggacca cagacatgaa ggacctgtct gcaagaaata 61 gaagaatcaa gtggagctca accagtgaat catccccata atgtagggaa accttagaga 121 ggagagccgg aaggatgtat gggttgttag gaaaatgtag gctaccagga gaaaatgaca 181 tcctctgtta ataaaatctg aggtgcgact cacataattg tcccaatttt taagattgat 241 ggggagcatg aagcacttat ttaaagtgtt gacaggcccc aataaatgca taaactgcat 301 aggactcatg tggtctgaat gtattttagg gctttctggg aattgtcttg acagagaacc 361 tgagctggac aaagcagcct tgatctgagt gagccaactg gcacaatgaa gctgtcaggt 421 atctttctgc tcctctctct ggctcttttc tgctttttat caggtgtctt cagtcaggga 481 ggacgggttg actgtggtga gttccaggac cccaaggtct actgcactcg ggaatcgaac 541 ccacactgtg gctctgatgg ccagacatac ggcaataaat gtgccttctg taaggccatg 601 gtgaaaagtg gtgggaagat tagcctaaag catcctggaa aatgctgagt aaaagccagt 661 gtttcttggt gacttgccag ctcttgcggc cttcttttct cacttctgct tatacttttg 721 ctagtggatt cttttaattc ataaagacat acccactctg cctgggtctt gaggagttga 781 acgtatgtct atttctcttg attcacttgt aaataaagta cattctgcaa aagca //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on