Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: QGSS01000272.1
FASTA Graphics
LOCUS QGSS01000272 2646 bp DNA linear ENV 14-AUG-2018 DEFINITION MAG: Bacillota bacterium isolate ZC3RG09 NODE_7515_length_2646_cov_4.822946, whole genome shotgun sequence. ACCESSION QGSS01000272 QGSS01000000 VERSION QGSS01000272.1 DBLINK BioProject: PRJNA420721 BioSample: SAMN09092868 KEYWORDS WGS; ENV; Metagenome Assembled Genome; MAG. SOURCE Bacillota bacterium (compost metagenome) ORGANISM Bacillota bacterium Bacteria; Bacillati; Bacillota. REFERENCE 1 (bases 1 to 2646) AUTHORS Moura,L. and Setubal,J.C. TITLE Direct Submission JOURNAL Submitted (08-MAY-2018) Bioquimica, Instituto de Quimica, Av. Prof. Lineu Prestes, 748, Sao Paulo, SP 05508-000, Brazil COMMENT Annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (released 2013). Information about the Pipeline can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: SPAdes v. 3.11 Genome Representation :: Full Expected Final Version :: Yes Genome Coverage :: 4.5x Sequencing Technology :: Illumina MiSeq ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Date :: 05/24/2018 16:54:04 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline Annotation Method :: Best-placed reference protein set; GeneMarkS+ Annotation Software revision :: 4.5 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total) :: 2,516 CDS (total) :: 2,463 Genes (coding) :: 2,432 CDS (coding) :: 2,432 Genes (RNA) :: 53 rRNAs :: 2, 1 (5S, 16S) complete rRNAs :: 2, 1 (5S, 16S) tRNAs :: 45 ncRNAs :: 5 Pseudo Genes (total) :: 31 Pseudo Genes (ambiguous residues) :: 0 of 31 Pseudo Genes (frameshifted) :: 2 of 31 Pseudo Genes (incomplete) :: 30 of 31 Pseudo Genes (internal stop) :: 0 of 31 Pseudo Genes (multiple problems) :: 1 of 31 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2646 /organism="Bacillota bacterium" /mol_type="genomic DNA" /submitter_seqid="NODE_7515_length_2646_cov_4.822946" /isolate="ZC3RG09" /isolation_source="Zoo Composter number 3" /db_xref="taxon:1879010" /environmental_sample /geo_loc_name="Brazil: Sao Paulo Zoo" /lat_lon="23.650840 S 46.620510 W" /collection_date="Jun-2011" /metagenome_source="compost metagenome" /note="metagenomic" gene complement(<1..677) /locus_tag="DIU82_11700" CDS complement(<1..677) /locus_tag="DIU82_11700" /inference="COORDINATES: protein motif:HMM:PF13458.4" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="branched chain amino acid ABC transporter substrate-binding protein" /protein_id="REJ32809.1" /translation="MFVSTEGQARALGFALVLALGFALGLAGVVPASAQQPIRIGLQG PITGPWALEGEMAVNSVQIVVDQINARGGILGRPVELVIGDDQGEVRQSALTAQRMVA EGVVAVISSYGSSITEAAQLIYEDAGLVNIAYGATAESLTQHGHRYFFRTSFRDDRQG DFFAELVTKHLNLQRVAIVHDNSTFARGLAEAARRSLAGKPGVEVVFYDAVTAGERDF TAVISRMR" gene complement(924..1346) /locus_tag="DIU82_11705" CDS complement(924..1346) /locus_tag="DIU82_11705" /inference="COORDINATES: ab initio prediction:GeneMarkS+" /note="Derived by automated computational analysis using gene prediction method: GeneMarkS+." /codon_start=1 /transl_table=11 /product="hypothetical protein" /protein_id="REJ32810.1" /translation="MPVTLTTGMFPVAQLPAAQVVSVRVFLGNLENRPHRASVTVSRL NGGAKELIRMEELEVPGDDVRTVELPSAEVEGHTIEVTVSVPTNGFGTGQLPVVPGVA VVSLFTGDQTTSILQWISSDGFVAVGETASPVPVRAGS" gene complement(1431..2300) /locus_tag="DIU82_11710" CDS complement(1431..2300) /locus_tag="DIU82_11710" /inference="COORDINATES: ab initio prediction:GeneMarkS+" /note="Derived by automated computational analysis using gene prediction method: GeneMarkS+." /codon_start=1 /transl_table=11 /product="hypothetical protein" /protein_id="REJ32811.1" /translation="MNRFKKRLVLTRTGGTIIRIRRRRGTARPRTAFDTAPELPAELA AYATEAAEQPMVTSESTAVEAEPVAQAEAAAQVTEAAAEATVAPARATDTPAQATDTP VQAADAPAQAADAPVELTGAQMTETAAQVTETAAQVTKAAVGPAESPLRAAAAPAEPA PGFPLSEPFRDELEVRGLRTTGLFAVPSDSVIQLVILISSFADQEQTANVWVRRVEDD ELRTVFFRSLTVPAGGVQQVTVDGLAGQTIRIDVEVPSDLLVPTAAITQYFLADGAII VRVYKSPADFVPV" gene 2486..>2646 /locus_tag="DIU82_11715" CDS 2486..>2646 /locus_tag="DIU82_11715" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_005120796.1" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="hypothetical protein" /protein_id="REJ32812.1" /translation="MSSVSAGESKRVLIVNADDLGLTDGVTEGIVQAWRGGVGTSAAA LINMEGGGGG" ORIGIN 1 cgcatgcggc tgatgacggc ggtgaagtcc cgctcgcccg cggtcaccgc atcatagaac 61 acgacttcca caccgggctt gcccgccagc gaccggcggg ccgcctcggc caggccccgg 121 gcgaaggtgg agttgtcatg cacgatcgcg acgcgctgca ggttcaggtg cttggtgacc 181 agctcggcga agaaatcgcc ctggcggtca tcgcggaagg aggttcggaa gaagtagcga 241 tggccgtgct gggtcaggct ctccgcggtg gcgccatagg cgatgttgac cagcccggcg 301 tcctcgtaga tgagctgtgc ggcttccgtg atcgacgaac cgtacgagct gatgacggcc 361 acgacgcctt cggcgaccat gcgctgggcc gtcaaggccg actggcgcac ctcgccctgg 421 tcgtcgccga tcacgagctc caccggccgg ccgaggatgc cgccccgggc gttgatctgg 481 tcaacgacaa tctgcacgga gttgaccgcc atctcgccct ccagcgccca cgggcccgta 541 atcggcccct gcaggccgat ccggatcggc tgctgcgcgc tggccggaac aacgcccgcc 601 aggcccagcg cgaagcccag ggcgagcacc agcgcaaaac ctaaggcgcg cgcctgcccc 661 tccgtcgaga caaacatccg acgctgcaag aaggttccct cctactcctg gtatgatatc 721 gaaaattcgc cgttgcgcat cttcggcgga gtgtatgggg atacctgctc tttgcgcaaa 781 ttcgcgcggg gtgggtgcgc tggccggcgc gcatcggcgc tgcgtactcc cgggcgcgcg 841 aatagcgcat gaggcggcgc atggcaggcg tgcatgggcg gtgctccagg aggcccggag 901 caggtgtgca ccggggtgcg aggctatgat ccggcgcgca ccggcaccgg gctggcggtt 961 tcaccgacgg caacgaaacc gtcggaggag atccattgca ggatggacgt ggtctgatcg 1021 ccggtaaaaa gggacactac cgcgacgccg ggcacgacgg gcagctggcc ggtgccaaag 1081 ccgttggtcg gcacggagac ggtaacctcg atggtgtgcc cttccacttc ggcgctcggc 1141 agctccacgg tccgcacgtc gtccccgggc acctccagtt cctccatccg gatgagctcc 1201 ttggcgccgc cgttcaagcg ggaaaccgtt acgcttgccc ggtgaggccg attttccaag 1261 ttgccgagaa acacccgcac cgacaccacc tgggccgcgg gcagctgggc cacgggaaac 1321 atgccggtgg tcaaggtcac aggcacggag cgattccccc tctaaacggc cagactaagc 1381 agccggacta gccgacccca aaccacgcaa gatcgattat tctaggcgtt ctagaccggc 1441 acaaagtccg caggcgactt gtagacacgg acgatgatgg ccccgtcggc taggaagtac 1501 tgggtgatcg ctgccgtggg caccaagaga tcggacggga cctccacgtc gatccggatc 1561 gtttggcccg cgagcccgtc cacggtcacc tgctgcacgc cgcccgcggg caccgtgagg 1621 gaccgaaaga acaccgtccg aagctcgtcg tcctccacgc gccgcaccca gacgttggcg 1681 gtctgctctt ggtcggcgaa gctgctaatc agtatgacca gctggatgac gctgtcgctg 1741 ggcacggcaa acaggccggt ggtgcgcagg ccccgtacct ccagctcatc ccggaaaggc 1801 tcgctcagcg ggaaaccggg ggctggttcg gccggcgccg cggctgctct gagcggggat 1861 tccgctgggc cgacggcggc tttcgtcacc tgggctgcag tctccgttac ctgggctgca 1921 gtctccgtca tttgcgctcc ggtcaactcg actggcgcat ccgccgcctg ggccggtgca 1981 tccgccgctt ggaccggcgt atccgttgcc tgggccggcg tatccgttgc ccgggccggt 2041 gcaaccgtcg cctcagccgc ggcttctgtc acctgagccg ctgcctccgc ctgggccacc 2101 ggctcggcct cgacagccgt tgactcgctg gttaccatcg gctgctccgc cgcctcggtt 2161 gcgtaggcgg ccaactctgc cggcagctcc ggcgcggtgt cgaaagctgt ccggggccga 2221 gccgtccccc gccggcgccg gatgcggatg atggtaccgc cggtgcgggt gagcacgagg 2281 cgcttcttga accggttcac gattcactcc ccttttccgc cgccgcggcc aagcgacagg 2341 atccgcggcc gtaacgtagg aatccgttac tggtgcgcta tgatatgcgg gcattgggct 2401 acgtggcccc acatcaccgc gggcatagcg ctggcatagg ggcgggctgc ccgcacccgc 2461 gggttgtgag gaggcgtcca gcggcatgtc gtcggtgtca gccggggaat cgaagcgggt 2521 tttgattgtc aacgcggacg atctcggtct tacggacggg gtcacggaag gcatcgtgca 2581 ggcgtggcgg gggggcgtgg ggacctccgc ggccgccctg atcaacatgg aggggggggg 2641 cggggg //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on