Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_WTER01000034.1
FASTA Graphics
LOCUS NZ_WTER01000034 1037 bp DNA linear CON 17-SEP-2024 DEFINITION Klebsiella pneumoniae strain K574 K574_34, whole genome shotgun sequence. ACCESSION NZ_WTER01000034 NZ_WTER01000000 VERSION NZ_WTER01000034.1 DBLINK BioProject: PRJNA224116 BioSample: SAMN13563931 Assembly: GCF_019401005.1 KEYWORDS WGS; RefSeq. SOURCE Klebsiella pneumoniae ORGANISM Klebsiella pneumoniae Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella/Raoultella group; Klebsiella; Klebsiella pneumoniae complex. REFERENCE 1 (bases 1 to 1037) AUTHORS Zhao,Q., Guo,L., Wang,L. and Shen,D. TITLE Emergency and characteristics of hypervirulent Klebsiella pneumoniae causing surgical site infection JOURNAL Unpublished REFERENCE 2 (bases 1 to 1037) AUTHORS Zhao,Q., Guo,L., Wang,L. and Shen,D. TITLE Direct Submission JOURNAL Submitted (17-DEC-2019) Medical Test Center, Chinese PLA General Hospital, Fuxing Street, Beijing 100853, China COMMENT REFSEQ INFORMATION: The reference sequence is identical to WTER01000034.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: SPAdes v. 3.12 Genome Representation :: Full Expected Final Version :: Yes Genome Coverage :: 100x Sequencing Technology :: Illumina HiSeq ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_019401005.1-RS_2024_09_17 Annotation Date :: 09/17/2024 07:00:02 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.8 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 5,289 CDSs (total) :: 5,193 Genes (coding) :: 5,094 CDSs (with protein) :: 5,094 Genes (RNA) :: 96 rRNAs :: 1, 2, 2 (5S, 16S, 23S) complete rRNAs :: 1 (5S) partial rRNAs :: 2, 2 (16S, 23S) tRNAs :: 80 ncRNAs :: 11 Pseudo Genes (total) :: 99 CDSs (without protein) :: 99 Pseudo Genes (ambiguous residues) :: 0 of 99 Pseudo Genes (frameshifted) :: 51 of 99 Pseudo Genes (incomplete) :: 50 of 99 Pseudo Genes (internal stop) :: 15 of 99 Pseudo Genes (multiple problems) :: 13 of 99 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1037 /organism="Klebsiella pneumoniae" /mol_type="genomic DNA" /submitter_seqid="K574_34" /strain="K574" /isolation_source="wound secretion" /host="Homo sapiens" /db_xref="taxon:573" /geo_loc_name="China: Beijing" /collection_date="2017-07-17" gene complement(<1..>1037) /gene="tuf" /locus_tag="GQQ73_RS26205" /old_locus_tag="GQQ73_25785" CDS complement(<1..>1037) /gene="tuf" /locus_tag="GQQ73_RS26205" /old_locus_tag="GQQ73_25785" /inference="COORDINATES: similar to AA sequence:RefSeq:YP_005224494.1" /GO_function="GO:0005525 - GTP binding [Evidence IEA]; GO:0003746 - translation elongation factor activity [Evidence IEA]" /GO_process="GO:0006414 - translational elongation [Evidence IEA]" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="elongation factor Tu" /protein_id="WP_020316953.1" /translation="LAKTYGGSARAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAH VDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNK CDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKIIELAGH LDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKETAK TTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTINPHTKFESEVYI LSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMVVTLIHPIAM DDGLRFAIREGG" CONTIG join(WTER01000034.1:1..1037) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on