U.S. flag

An official website of the United States government

Pseudomonas aeruginosa strain VET-32 NODE_87_length_391_cov_172.688_ID_173, whole genome shotgun sequence

NCBI Reference Sequence: NZ_RADC01000082.1

FASTA Graphics 

LOCUS       NZ_RADC01000082          391 bp    DNA     linear   CON 19-MAY-2024
DEFINITION  Pseudomonas aeruginosa strain VET-32
            NODE_87_length_391_cov_172.688_ID_173, whole genome shotgun
            sequence.
ACCESSION   NZ_RADC01000082 NZ_RADC01000000
VERSION     NZ_RADC01000082.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN09478095
            Assembly: GCF_003630365.1
KEYWORDS    WGS; RefSeq.
SOURCE      Pseudomonas aeruginosa
  ORGANISM  Pseudomonas aeruginosa
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Pseudomonadales; Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 391)
  AUTHORS   Laht,M., Telling,K., Kalmus,P., Corander,J., Lutsad,I., Tenson,T.
            and Kisand,V.
  TITLE     Pseudomonas aeruginosa distribution among humans, animals and the
            environment
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 391)
  AUTHORS   Kisand,V.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2018) Institute of Technology, University of
            Tartu, Nooruse 1, Tartu 50411, Estonia
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            RADC01000082.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: SPAdes v. 3.5.0
            Genome Representation  :: Full
            Expected Final Version :: No
            Genome Coverage        :: 165x
            Sequencing Technology  :: Illumina HiSeq 2500
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_003630365.1-RS_2024_05_19
            Annotation Date                   :: 05/19/2024 02:53:44
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.7
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 6,049
            CDSs (total)                      :: 5,978
            Genes (coding)                    :: 5,915
            CDSs (with protein)               :: 5,915
            Genes (RNA)                       :: 71
            rRNAs                             :: 1, 2, 6 (5S, 16S, 23S)
            complete rRNAs                    :: 1 (5S)
            partial rRNAs                     :: 2, 6 (16S, 23S)
            tRNAs                             :: 58
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 63
            CDSs (without protein)            :: 63
            Pseudo Genes (ambiguous residues) :: 0 of 63
            Pseudo Genes (frameshifted)       :: 14 of 63
            Pseudo Genes (incomplete)         :: 54 of 63
            Pseudo Genes (internal stop)      :: 3 of 63
            Pseudo Genes (multiple problems)  :: 7 of 63
            CRISPR Arrays                     :: 3
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..391
                     /organism="Pseudomonas aeruginosa"
                     /mol_type="genomic DNA"
                     /submitter_seqid="NODE_87_length_391_cov_172.688_ID_173"
                     /strain="VET-32"
                     /isolation_source="milk"
                     /host="bovine"
                     /db_xref="taxon:287"
                     /geo_loc_name="Estonia"
                     /lat_lon="58.3632291 N 26.6818143 E"
                     /collection_date="2013"
     gene            <1..>391
                     /locus_tag="DQI06_RS27440"
     CDS             <1..>391
                     /locus_tag="DQI06_RS27440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_250248.1"
                     /GO_component="GO:0016020 - membrane [Evidence IEA]"
                     /GO_function="GO:0004129 - cytochrome-c oxidase activity
                     [Evidence IEA]; GO:0020037 - heme binding [Evidence IEA]"
                     /GO_process="GO:0009060 - aerobic respiration [Evidence
                     IEA]"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=3
                     /transl_table=11
                     /product="cbb3-type cytochrome c oxidase subunit I"
                     /protein_id="WP_171943342.1"
                     /translation="GFLGMMYYFVPKQAERPVYSYRLSIVHFWALIAVYIWAGPHHLH
                     YTALPDWAQSLGMVMSLILLAPSWGGMINGMMTLSGAWHKLRSDPILRFLVVSLAFYG
                     MSTFEGPMMAIKTVNALSHYTDWTIGHV"
CONTIG      join(RADC01000082.1:1..391)
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.