Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_RADC01000082.1
FASTA Graphics
LOCUS NZ_RADC01000082 391 bp DNA linear CON 19-MAY-2024 DEFINITION Pseudomonas aeruginosa strain VET-32 NODE_87_length_391_cov_172.688_ID_173, whole genome shotgun sequence. ACCESSION NZ_RADC01000082 NZ_RADC01000000 VERSION NZ_RADC01000082.1 DBLINK BioProject: PRJNA224116 BioSample: SAMN09478095 Assembly: GCF_003630365.1 KEYWORDS WGS; RefSeq. SOURCE Pseudomonas aeruginosa ORGANISM Pseudomonas aeruginosa Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 391) AUTHORS Laht,M., Telling,K., Kalmus,P., Corander,J., Lutsad,I., Tenson,T. and Kisand,V. TITLE Pseudomonas aeruginosa distribution among humans, animals and the environment JOURNAL Unpublished REFERENCE 2 (bases 1 to 391) AUTHORS Kisand,V. TITLE Direct Submission JOURNAL Submitted (25-JUN-2018) Institute of Technology, University of Tartu, Nooruse 1, Tartu 50411, Estonia COMMENT REFSEQ INFORMATION: The reference sequence is identical to RADC01000082.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: SPAdes v. 3.5.0 Genome Representation :: Full Expected Final Version :: No Genome Coverage :: 165x Sequencing Technology :: Illumina HiSeq 2500 ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_003630365.1-RS_2024_05_19 Annotation Date :: 05/19/2024 02:53:44 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.7 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 6,049 CDSs (total) :: 5,978 Genes (coding) :: 5,915 CDSs (with protein) :: 5,915 Genes (RNA) :: 71 rRNAs :: 1, 2, 6 (5S, 16S, 23S) complete rRNAs :: 1 (5S) partial rRNAs :: 2, 6 (16S, 23S) tRNAs :: 58 ncRNAs :: 4 Pseudo Genes (total) :: 63 CDSs (without protein) :: 63 Pseudo Genes (ambiguous residues) :: 0 of 63 Pseudo Genes (frameshifted) :: 14 of 63 Pseudo Genes (incomplete) :: 54 of 63 Pseudo Genes (internal stop) :: 3 of 63 Pseudo Genes (multiple problems) :: 7 of 63 CRISPR Arrays :: 3 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..391 /organism="Pseudomonas aeruginosa" /mol_type="genomic DNA" /submitter_seqid="NODE_87_length_391_cov_172.688_ID_173" /strain="VET-32" /isolation_source="milk" /host="bovine" /db_xref="taxon:287" /geo_loc_name="Estonia" /lat_lon="58.3632291 N 26.6818143 E" /collection_date="2013" gene <1..>391 /locus_tag="DQI06_RS27440" CDS <1..>391 /locus_tag="DQI06_RS27440" /inference="COORDINATES: similar to AA sequence:RefSeq:NP_250248.1" /GO_component="GO:0016020 - membrane [Evidence IEA]" /GO_function="GO:0004129 - cytochrome-c oxidase activity [Evidence IEA]; GO:0020037 - heme binding [Evidence IEA]" /GO_process="GO:0009060 - aerobic respiration [Evidence IEA]" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=3 /transl_table=11 /product="cbb3-type cytochrome c oxidase subunit I" /protein_id="WP_171943342.1" /translation="GFLGMMYYFVPKQAERPVYSYRLSIVHFWALIAVYIWAGPHHLH YTALPDWAQSLGMVMSLILLAPSWGGMINGMMTLSGAWHKLRSDPILRFLVVSLAFYG MSTFEGPMMAIKTVNALSHYTDWTIGHV" CONTIG join(RADC01000082.1:1..391) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on