Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_JBJDRC010000119.1
FASTA Graphics
LOCUS NZ_JBJDRC010000119 214 bp DNA linear CON 22-NOV-2024 DEFINITION Streptomyces sp. MPA0124 119, whole genome shotgun sequence. ACCESSION NZ_JBJDRC010000119 NZ_JBJDRC010000000 VERSION NZ_JBJDRC010000119.1 DBLINK BioProject: PRJNA224116 BioSample: SAMN44567533 Assembly: GCF_044987335.1 KEYWORDS WGS; RefSeq. SOURCE Streptomyces sp. MPA0124 ORGANISM Streptomyces sp. MPA0124 Bacteria; Bacillati; Actinomycetota; Actinomycetes; Kitasatosporales; Streptomycetaceae; Streptomyces. REFERENCE 1 (bases 1 to 214) AUTHORS Prathaban,M., Sobanaa,M., Prathiviraj,R., Hari Krishna Kumar,S. and Joseph,S. TITLE Streptomyces Bacterias isolated from wetland sediments JOURNAL Unpublished REFERENCE 2 (bases 1 to 214) AUTHORS Prathaban,M., Sobanaa,M., Prathiviraj,R., Hari Krishna Kumar,S. and Joseph,S. TITLE Direct Submission JOURNAL Submitted (06-NOV-2024) Microbiology, Pondicherry University, Chinna Kalapet, Puducherry, Puducherry 605014, India COMMENT REFSEQ INFORMATION: The reference sequence is identical to JBJDRC010000119.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: SPAdes v. 4.0.0 Genome Representation :: Full Expected Final Version :: Yes Genome Coverage :: 80x Sequencing Technology :: Illumina HiSeq ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_044987335.1-RS_2024_11_18 Annotation Date :: 11/18/2024 15:17:26 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.9 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 7,358 CDSs (total) :: 7,285 Genes (coding) :: 7,151 CDSs (with protein) :: 7,151 Genes (RNA) :: 73 rRNAs :: 1, 1, 2 (5S, 16S, 23S) complete rRNAs :: 1, 1 (5S, 16S) partial rRNAs :: 2 (23S) tRNAs :: 66 ncRNAs :: 3 Pseudo Genes (total) :: 134 CDSs (without protein) :: 134 Pseudo Genes (ambiguous residues) :: 0 of 134 Pseudo Genes (frameshifted) :: 60 of 134 Pseudo Genes (incomplete) :: 99 of 134 Pseudo Genes (internal stop) :: 10 of 134 Pseudo Genes (multiple problems) :: 30 of 134 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..214 /organism="Streptomyces sp. MPA0124" /mol_type="genomic DNA" /strain="MPA0124" /isolation_source="environmental" /db_xref="taxon:3378069" /geo_loc_name="India: Pondicherry" /collection_date="2023-01" gene complement(<1..>214) /locus_tag="ACI3K5_RS36775" /old_locus_tag="ACI3K5_36775" CDS complement(<1..>214) /locus_tag="ACI3K5_RS36775" /old_locus_tag="ACI3K5_36775" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_020117911.1" /GO_function="GO:0003824 - catalytic activity [Evidence IEA]" /GO_process="GO:0005975 - carbohydrate metabolic process [Evidence IEA]" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="alpha-amylase family glycosyl hydrolase" /protein_id="WP_404965632.1" /translation="GYDVSDYTAVLPEFGDLADFVEFVDAAHQRGMRVIIDFVMNHTS DQHPWFQESRKNPDGPYGDYYVWADDD" CONTIG join(JBJDRC010000119.1:1..214) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on