U.S. flag

An official website of the United States government

Streptomyces sp. MPA0124 119, whole genome shotgun sequence

NCBI Reference Sequence: NZ_JBJDRC010000119.1

FASTA Graphics 

LOCUS       NZ_JBJDRC010000119       214 bp    DNA     linear   CON 22-NOV-2024
DEFINITION  Streptomyces sp. MPA0124 119, whole genome shotgun sequence.
ACCESSION   NZ_JBJDRC010000119 NZ_JBJDRC010000000
VERSION     NZ_JBJDRC010000119.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN44567533
            Assembly: GCF_044987335.1
KEYWORDS    WGS; RefSeq.
SOURCE      Streptomyces sp. MPA0124
  ORGANISM  Streptomyces sp. MPA0124
            Bacteria; Bacillati; Actinomycetota; Actinomycetes;
            Kitasatosporales; Streptomycetaceae; Streptomyces.
REFERENCE   1  (bases 1 to 214)
  AUTHORS   Prathaban,M., Sobanaa,M., Prathiviraj,R., Hari Krishna Kumar,S. and
            Joseph,S.
  TITLE     Streptomyces Bacterias isolated from wetland sediments
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 214)
  AUTHORS   Prathaban,M., Sobanaa,M., Prathiviraj,R., Hari Krishna Kumar,S. and
            Joseph,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-NOV-2024) Microbiology, Pondicherry University,
            Chinna Kalapet, Puducherry, Puducherry 605014, India
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            JBJDRC010000119.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: SPAdes v. 4.0.0
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 80x
            Sequencing Technology  :: Illumina HiSeq
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_044987335.1-RS_2024_11_18
            Annotation Date                   :: 11/18/2024 15:17:26
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.9
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 7,358
            CDSs (total)                      :: 7,285
            Genes (coding)                    :: 7,151
            CDSs (with protein)               :: 7,151
            Genes (RNA)                       :: 73
            rRNAs                             :: 1, 1, 2 (5S, 16S, 23S)
            complete rRNAs                    :: 1, 1 (5S, 16S)
            partial rRNAs                     :: 2 (23S)
            tRNAs                             :: 66
            ncRNAs                            :: 3
            Pseudo Genes (total)              :: 134
            CDSs (without protein)            :: 134
            Pseudo Genes (ambiguous residues) :: 0 of 134
            Pseudo Genes (frameshifted)       :: 60 of 134
            Pseudo Genes (incomplete)         :: 99 of 134
            Pseudo Genes (internal stop)      :: 10 of 134
            Pseudo Genes (multiple problems)  :: 30 of 134
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..214
                     /organism="Streptomyces sp. MPA0124"
                     /mol_type="genomic DNA"
                     /strain="MPA0124"
                     /isolation_source="environmental"
                     /db_xref="taxon:3378069"
                     /geo_loc_name="India: Pondicherry"
                     /collection_date="2023-01"
     gene            complement(<1..>214)
                     /locus_tag="ACI3K5_RS36775"
                     /old_locus_tag="ACI3K5_36775"
     CDS             complement(<1..>214)
                     /locus_tag="ACI3K5_RS36775"
                     /old_locus_tag="ACI3K5_36775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020117911.1"
                     /GO_function="GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /GO_process="GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-amylase family glycosyl hydrolase"
                     /protein_id="WP_404965632.1"
                     /translation="GYDVSDYTAVLPEFGDLADFVEFVDAAHQRGMRVIIDFVMNHTS
                     DQHPWFQESRKNPDGPYGDYYVWADDD"
CONTIG      join(JBJDRC010000119.1:1..214)
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.