Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_JASSPO010000078.1
FASTA Graphics
LOCUS NZ_JASSPO010000078 370 bp DNA linear CON 12-DEC-2024 DEFINITION Sneathia vaginalis strain CCUG 52976 CCUG52976_contig_00106, whole genome shotgun sequence. ACCESSION NZ_JASSPO010000078 NZ_JASSPO010000000 VERSION NZ_JASSPO010000078.1 DBLINK BioProject: PRJNA224116 BioSample: SAMN35558468 Assembly: GCF_030238485.1 KEYWORDS WGS; RefSeq. SOURCE Sneathia vaginalis ORGANISM Sneathia vaginalis Bacteria; Fusobacteriati; Fusobacteriota; Fusobacteriia; Fusobacteriales; Leptotrichiaceae; Sneathia. REFERENCE 1 (bases 1 to 370) AUTHORS Mccoy,Z.T., Serrano,M.G., Spaine,K., Edwards,D.J., Buck,G.A. and Jefferson,K. TITLE Antibody response to the Sneathia vaginalis cytopathogenic toxin A during pregnancy JOURNAL Unpublished REFERENCE 2 (bases 1 to 370) AUTHORS Jefferson,K., Serrano,M.G. and Buck,G.A. TITLE Direct Submission JOURNAL Submitted (01-JUN-2023) Microbiology and Immunology, Virginia Commonwealth University, 1101 E Marshall St, Richmond, VA 23298, USA COMMENT REFSEQ INFORMATION: The reference sequence is identical to JASSPO010000078.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Date :: 15-APR-2013 Assembly Method :: Newbler v. 2.8 Genome Representation :: Full Expected Final Version :: Yes Genome Coverage :: 14.0x Sequencing Technology :: 454 ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_030238485.1-RS_2024_12_11 Annotation Date :: 12/11/2024 19:04:41 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.9 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 1,509 CDSs (total) :: 1,450 Genes (coding) :: 1,344 CDSs (with protein) :: 1,344 Genes (RNA) :: 59 rRNAs :: 5, 7, 4 (5S, 16S, 23S) complete rRNAs :: 5, 1, 1 (5S, 16S, 23S) partial rRNAs :: 6, 3 (16S, 23S) tRNAs :: 39 ncRNAs :: 4 Pseudo Genes (total) :: 106 CDSs (without protein) :: 106 Pseudo Genes (ambiguous residues) :: 1 of 106 Pseudo Genes (frameshifted) :: 65 of 106 Pseudo Genes (incomplete) :: 48 of 106 Pseudo Genes (internal stop) :: 8 of 106 Pseudo Genes (multiple problems) :: 15 of 106 CRISPR Arrays :: 2 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..370 /organism="Sneathia vaginalis" /mol_type="genomic DNA" /submitter_seqid="CCUG52976_contig_00106" /strain="CCUG 52976" /isolation_source="human blood" /host="Homo sapiens" /db_xref="taxon:187101" /geo_loc_name="France: Strasbourg" /collection_date="2004" gene 122..295 /locus_tag="QQA44_RS07465" /old_locus_tag="QQA44_07470" CDS 122..295 /locus_tag="QQA44_RS07465" /old_locus_tag="QQA44_07470" /inference="COORDINATES: protein motif:HMM:NF037419.5" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="PBECR4 domain-containing protein" /protein_id="WP_285162550.1" /translation="MNKIKEIYNWYKQFNNKEIVIQTENKNLGIKITNTALPHLLGLQ YIEEKATKLIGQI" CONTIG join(JASSPO010000078.1:1..370) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on