Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_CYMQ01000019.1
FASTA Graphics
LOCUS NZ_CYMQ01000019 3278 bp DNA linear CON 04-DEC-2023 DEFINITION Staphylococcus aureus strain MRSA, whole genome shotgun sequence. ACCESSION NZ_CYMQ01000019 NZ_CYMQ01000000 VERSION NZ_CYMQ01000019.1 DBLINK BioProject: PRJNA224116 BioSample: SAMEA2384637 Assembly: GCF_001287885.1 KEYWORDS WGS; RefSeq. SOURCE Staphylococcus aureus ORGANISM Staphylococcus aureus Bacteria; Bacillati; Bacillota; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus. REFERENCE 1 AUTHORS Informatics,Pathogen. TITLE Direct Submission JOURNAL Submitted (02-SEP-2015) SC, Wellcome Trust Sanger Institute, CB10 1SA, United Kingdom COMMENT REFSEQ INFORMATION: The reference sequence is identical to CYMQ01000019.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Date :: 12/04/2023 02:11:32 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.6 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 2,923 CDSs (total) :: 2,854 Genes (coding) :: 2,763 CDSs (with protein) :: 2,763 Genes (RNA) :: 69 rRNAs :: 3, 3, 1 (5S, 16S, 23S) complete rRNAs :: 3, 1, 1 (5S, 16S, 23S) partial rRNAs :: 2 (16S) tRNAs :: 58 ncRNAs :: 4 Pseudo Genes (total) :: 91 CDSs (without protein) :: 91 Pseudo Genes (ambiguous residues) :: 0 of 91 Pseudo Genes (frameshifted) :: 43 of 91 Pseudo Genes (incomplete) :: 50 of 91 Pseudo Genes (internal stop) :: 20 of 91 Pseudo Genes (multiple problems) :: 21 of 91 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..3278 /organism="Staphylococcus aureus" /mol_type="genomic DNA" /strain="MRSA" /isolation_source="Wound" /db_xref="taxon:1280" /geo_loc_name="USA" /collection_date="2004" gene <177..812 /locus_tag="AOI28_RS15575" /pseudo CDS <177..812 /locus_tag="AOI28_RS15575" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_003454325.1" /note="internal stop; incomplete; partial in the middle of a contig; missing N-terminus; Derived by automated computational analysis using gene prediction method: Protein Homology." /pseudo /codon_start=1 /transl_table=11 /product="aminoglycoside 6-adenylyltransferase" gene 809..1339 /gene="sat4" /locus_tag="AOI28_RS14850" /old_locus_tag="ERS410962_02791" CDS 809..1339 /gene="sat4" /locus_tag="AOI28_RS14850" /old_locus_tag="ERS410962_02791" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_000627290.1" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="streptothricin N-acetyltransferase Sat4" /protein_id="WP_000627289.1" /translation="MITEMKAGHLKDIDKPSEPFEVIGKIIPRYENENWTFTELLYEA PYLKSYQDEEDEEDEEADCLEYIDNTDKIIYLYYQDDKCVGKVKLRKNWNRYAYIEDI AVCKDFRGQGIGSALINISIEWAKHKNLHGLMLETQDNNLIACKFYHNCGFKIGSVDT MLYANFEKAVFWYLRF" gene 1432..2226 /gene="aph(3')-IIIa" /locus_tag="AOI28_RS14855" /old_locus_tag="ERS410962_02792" CDS 1432..2226 /gene="aph(3')-IIIa" /locus_tag="AOI28_RS14855" /old_locus_tag="ERS410962_02792" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_032491780.1" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="aminoglycoside O-phosphotransferase APH(3')-IIIa" /protein_id="WP_001096887.1" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLK MTDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEY EDEQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWE EDTPFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKW YDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" gene 2502..3073 /locus_tag="AOI28_RS15585" /pseudo CDS 2502..3073 /locus_tag="AOI28_RS15585" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_001079940.1" /note="frameshifted; Derived by automated computational analysis using gene prediction method: Protein Homology." /pseudo /codon_start=1 /transl_table=11 /product="HTH domain-containing protein" CONTIG join(CYMQ01000019.1:1..3278) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on