U.S. flag

An official website of the United States government

Escherichia coli strain ECSC024 sequence75, whole genome shotgun sequence

NCBI Reference Sequence: NZ_BFHT01000075.1

FASTA Graphics 

LOCUS       NZ_BFHT01000075          652 bp    DNA     linear   CON 23-AUG-2024
DEFINITION  Escherichia coli strain ECSC024 sequence75, whole genome shotgun
            sequence.
ACCESSION   NZ_BFHT01000075 NZ_BFHT01000000
VERSION     NZ_BFHT01000075.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMD00076998
            Sequence Read Archive: DRR102590
            Assembly: GCF_005382525.1
KEYWORDS    WGS; RefSeq; STANDARD_DRAFT.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Enterobacterales; Enterobacteriaceae; Escherichia.
REFERENCE   1
  AUTHORS   Arimizu,Y. and Ogura,Y.
  TITLE     Large scale genomics of bovine and human commensal E. coli to
            reveal the emerging process of EHEC
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 652)
  AUTHORS   Arimizu,Y., Tanizawa,Y. and Ogura,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-APR-2018) Contact:Yoshitoshi Ogura Kyushu University,
            Department of Bacteriology, Faculty of Medical Sciences; 3-1-1,
            Maidashi, Higashi-ku, Fukuoka 812-8582, Japan URL
            :http://www.bact.med.kyushu-u.ac.jp
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            BFHT01000075.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Platanus v. 1.2.2
            Genome Coverage       :: 50x
            Sequencing Technology :: Illumina MiSeq
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_005382525.1-RS_2024_08_23
            Annotation Date                   :: 08/23/2024 20:11:09
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.8
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 5,128
            CDSs (total)                      :: 5,018
            Genes (coding)                    :: 4,787
            CDSs (with protein)               :: 4,787
            Genes (RNA)                       :: 110
            rRNAs                             :: 8, 6, 11 (5S, 16S, 23S)
            complete rRNAs                    :: 7 (5S)
            partial rRNAs                     :: 1, 6, 11 (5S, 16S, 23S)
            tRNAs                             :: 79
            ncRNAs                            :: 6
            Pseudo Genes (total)              :: 231
            CDSs (without protein)            :: 231
            Pseudo Genes (ambiguous residues) :: 0 of 231
            Pseudo Genes (frameshifted)       :: 92 of 231
            Pseudo Genes (incomplete)         :: 162 of 231
            Pseudo Genes (internal stop)      :: 34 of 231
            Pseudo Genes (multiple problems)  :: 51 of 231
            Pseudo Genes (short protein)      :: 1 of 231
            CRISPR Arrays                     :: 2
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..652
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /submitter_seqid="sequence75"
                     /strain="ECSC024"
                     /isolation_source="blood"
                     /host="Homo sapiens"
                     /db_xref="taxon:562"
                     /geo_loc_name="Japan"
                     /collection_date="2008"
     gene            <1..296
                     /locus_tag="FE926_RS24610"
                     /old_locus_tag="ExPECSC024_04650"
                     /pseudo
     CDS             <1..296
                     /locus_tag="FE926_RS24610"
                     /old_locus_tag="ExPECSC024_04650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001774307.1"
                     /note="incomplete; too short partial abutting assembly
                     gap; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=3
                     /transl_table=11
                     /product="conjugal transfer protein TraG"
     gene            318..>652
                     /locus_tag="FE926_RS24615"
     CDS             318..>652
                     /locus_tag="FE926_RS24615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016236308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="surface exclusion protein"
                     /protein_id="WP_137427926.1"
                     /translation="MRCLTHITLVTVIQFIACYLAGWGNAETIFMLFFIVLWQGLFIW
                     LFSQIRKKRNVSDEFKFSKGVWYITIPVSSLLSPLLSLMVFIIGTLYELRRVSGCVSV
                     REWMQSQVN"
CONTIG      join(BFHT01000075.1:1..652)
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.