Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_BFHT01000075.1
FASTA Graphics
LOCUS NZ_BFHT01000075 652 bp DNA linear CON 23-AUG-2024 DEFINITION Escherichia coli strain ECSC024 sequence75, whole genome shotgun sequence. ACCESSION NZ_BFHT01000075 NZ_BFHT01000000 VERSION NZ_BFHT01000075.1 DBLINK BioProject: PRJNA224116 BioSample: SAMD00076998 Sequence Read Archive: DRR102590 Assembly: GCF_005382525.1 KEYWORDS WGS; RefSeq; STANDARD_DRAFT. SOURCE Escherichia coli ORGANISM Escherichia coli Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia. REFERENCE 1 AUTHORS Arimizu,Y. and Ogura,Y. TITLE Large scale genomics of bovine and human commensal E. coli to reveal the emerging process of EHEC JOURNAL Unpublished REFERENCE 2 (bases 1 to 652) AUTHORS Arimizu,Y., Tanizawa,Y. and Ogura,Y. TITLE Direct Submission JOURNAL Submitted (24-APR-2018) Contact:Yoshitoshi Ogura Kyushu University, Department of Bacteriology, Faculty of Medical Sciences; 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582, Japan URL :http://www.bact.med.kyushu-u.ac.jp COMMENT REFSEQ INFORMATION: The reference sequence is identical to BFHT01000075.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: Platanus v. 1.2.2 Genome Coverage :: 50x Sequencing Technology :: Illumina MiSeq ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_005382525.1-RS_2024_08_23 Annotation Date :: 08/23/2024 20:11:09 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.8 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 5,128 CDSs (total) :: 5,018 Genes (coding) :: 4,787 CDSs (with protein) :: 4,787 Genes (RNA) :: 110 rRNAs :: 8, 6, 11 (5S, 16S, 23S) complete rRNAs :: 7 (5S) partial rRNAs :: 1, 6, 11 (5S, 16S, 23S) tRNAs :: 79 ncRNAs :: 6 Pseudo Genes (total) :: 231 CDSs (without protein) :: 231 Pseudo Genes (ambiguous residues) :: 0 of 231 Pseudo Genes (frameshifted) :: 92 of 231 Pseudo Genes (incomplete) :: 162 of 231 Pseudo Genes (internal stop) :: 34 of 231 Pseudo Genes (multiple problems) :: 51 of 231 Pseudo Genes (short protein) :: 1 of 231 CRISPR Arrays :: 2 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..652 /organism="Escherichia coli" /mol_type="genomic DNA" /submitter_seqid="sequence75" /strain="ECSC024" /isolation_source="blood" /host="Homo sapiens" /db_xref="taxon:562" /geo_loc_name="Japan" /collection_date="2008" gene <1..296 /locus_tag="FE926_RS24610" /old_locus_tag="ExPECSC024_04650" /pseudo CDS <1..296 /locus_tag="FE926_RS24610" /old_locus_tag="ExPECSC024_04650" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_001774307.1" /note="incomplete; too short partial abutting assembly gap; missing N-terminus; Derived by automated computational analysis using gene prediction method: Protein Homology." /pseudo /codon_start=3 /transl_table=11 /product="conjugal transfer protein TraG" gene 318..>652 /locus_tag="FE926_RS24615" CDS 318..>652 /locus_tag="FE926_RS24615" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_016236308.1" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="surface exclusion protein" /protein_id="WP_137427926.1" /translation="MRCLTHITLVTVIQFIACYLAGWGNAETIFMLFFIVLWQGLFIW LFSQIRKKRNVSDEFKFSKGVWYITIPVSSLLSPLLSLMVFIIGTLYELRRVSGCVSV REWMQSQVN" CONTIG join(BFHT01000075.1:1..652) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on