Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_AEJX01000506.1
FASTA Graphics
LOCUS NZ_AEJX01000506 579 bp DNA linear CON 20-MAR-2024 DEFINITION Escherichia sp. TW15838 contig_506, whole genome shotgun sequence. ACCESSION NZ_AEJX01000506 NZ_AEJX01000000 VERSION NZ_AEJX01000506.1 DBLINK BioProject: PRJNA224116 BioSample: SAMN02469832 Assembly: GCF_000208485.1 KEYWORDS WGS; RefSeq. SOURCE Escherichia sp. TW15838 ORGANISM Escherichia sp. TW15838 Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 579) AUTHORS Luo,C., Walk,S.T., Gordon,D.M., Feldgarden,M., Tiedje,J.M. and Konstantinidis,K.T. TITLE Genome sequencing of environmental Escherichia coli expands understanding of the ecology and speciation of the model bacterial species JOURNAL Proc Natl Acad Sci U S A 108 (17), 7200-7205 (2011) PUBMED 21482770 REFERENCE 2 (bases 1 to 579) AUTHORS Luo,C., Walk,S., Gordon,D.M., Feldgarden,M., Tiedje,J. and Konstantinidis,K.T. TITLE Direct Submission JOURNAL Submitted (21-OCT-2010) Center for Bioinformatics and Computational Genomics, and School of Biology, and School of Civil and Environmental Engineering, Georgia Institute of Technology, 311 Ferst Drive, Atlanta, GA 30332, USA COMMENT REFSEQ INFORMATION: The reference sequence is identical to AEJX01000506.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: Velvet v. 0.7.51 Genome Coverage :: 600x Sequencing Technology :: Illumina ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_000208485.1-RS_2024_03_20 Annotation Date :: 03/20/2024 01:53:25 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.7 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 5,301 CDSs (total) :: 5,264 Genes (coding) :: 4,975 CDSs (with protein) :: 4,975 Genes (RNA) :: 37 rRNAs :: 2, 3 (16S, 23S) partial rRNAs :: 2, 3 (16S, 23S) tRNAs :: 24 ncRNAs :: 8 Pseudo Genes (total) :: 289 CDSs (without protein) :: 289 Pseudo Genes (ambiguous residues) :: 0 of 289 Pseudo Genes (frameshifted) :: 74 of 289 Pseudo Genes (incomplete) :: 216 of 289 Pseudo Genes (internal stop) :: 43 of 289 Pseudo Genes (multiple problems) :: 41 of 289 Pseudo Genes (short protein) :: 3 of 289 CRISPR Arrays :: 3 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..579 /organism="Escherichia sp. TW15838" /mol_type="genomic DNA" /submitter_seqid="contig_506" /strain="TW15838" /db_xref="taxon:910237" gene complement(<1..153) /locus_tag="EQS_RS30310" /pseudo CDS complement(<1..153) /locus_tag="EQS_RS30310" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_000369293.1" /note="incomplete; too short partial abutting assembly gap; missing C-terminus; Derived by automated computational analysis using gene prediction method: Protein Homology." /pseudo /codon_start=1 /transl_table=11 /product="type III effector protein" gene 451..>579 /locus_tag="EQS_RS30865" CDS 451..>579 /locus_tag="EQS_RS30865" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_000225945.1" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="hypothetical protein" /protein_id="WP_237710183.1" /translation="MVAKLRSDVLINTNPFSEVKYEKHKHNGYSDKVTLDINNKKYD" CONTIG join(AEJX01000506.1:1..579) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on