U.S. flag

An official website of the United States government

Escherichia sp. TW15838 contig_506, whole genome shotgun sequence

NCBI Reference Sequence: NZ_AEJX01000506.1

FASTA Graphics 

LOCUS       NZ_AEJX01000506          579 bp    DNA     linear   CON 20-MAR-2024
DEFINITION  Escherichia sp. TW15838 contig_506, whole genome shotgun sequence.
ACCESSION   NZ_AEJX01000506 NZ_AEJX01000000
VERSION     NZ_AEJX01000506.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02469832
            Assembly: GCF_000208485.1
KEYWORDS    WGS; RefSeq.
SOURCE      Escherichia sp. TW15838
  ORGANISM  Escherichia sp. TW15838
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Enterobacterales; Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 579)
  AUTHORS   Luo,C., Walk,S.T., Gordon,D.M., Feldgarden,M., Tiedje,J.M. and
            Konstantinidis,K.T.
  TITLE     Genome sequencing of environmental Escherichia coli expands
            understanding of the ecology and speciation of the model bacterial
            species
  JOURNAL   Proc Natl Acad Sci U S A 108 (17), 7200-7205 (2011)
   PUBMED   21482770
REFERENCE   2  (bases 1 to 579)
  AUTHORS   Luo,C., Walk,S., Gordon,D.M., Feldgarden,M., Tiedje,J. and
            Konstantinidis,K.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-OCT-2010) Center for Bioinformatics and Computational
            Genomics, and School of Biology, and School of Civil and
            Environmental Engineering, Georgia Institute of Technology, 311
            Ferst Drive, Atlanta, GA 30332, USA
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            AEJX01000506.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Velvet v. 0.7.51
            Genome Coverage       :: 600x
            Sequencing Technology :: Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_000208485.1-RS_2024_03_20
            Annotation Date                   :: 03/20/2024 01:53:25
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.7
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 5,301
            CDSs (total)                      :: 5,264
            Genes (coding)                    :: 4,975
            CDSs (with protein)               :: 4,975
            Genes (RNA)                       :: 37
            rRNAs                             :: 2, 3 (16S, 23S)
            partial rRNAs                     :: 2, 3 (16S, 23S)
            tRNAs                             :: 24
            ncRNAs                            :: 8
            Pseudo Genes (total)              :: 289
            CDSs (without protein)            :: 289
            Pseudo Genes (ambiguous residues) :: 0 of 289
            Pseudo Genes (frameshifted)       :: 74 of 289
            Pseudo Genes (incomplete)         :: 216 of 289
            Pseudo Genes (internal stop)      :: 43 of 289
            Pseudo Genes (multiple problems)  :: 41 of 289
            Pseudo Genes (short protein)      :: 3 of 289
            CRISPR Arrays                     :: 3
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..579
                     /organism="Escherichia sp. TW15838"
                     /mol_type="genomic DNA"
                     /submitter_seqid="contig_506"
                     /strain="TW15838"
                     /db_xref="taxon:910237"
     gene            complement(<1..153)
                     /locus_tag="EQS_RS30310"
                     /pseudo
     CDS             complement(<1..153)
                     /locus_tag="EQS_RS30310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000369293.1"
                     /note="incomplete; too short partial abutting assembly
                     gap; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="type III effector protein"
     gene            451..>579
                     /locus_tag="EQS_RS30865"
     CDS             451..>579
                     /locus_tag="EQS_RS30865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000225945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_237710183.1"
                     /translation="MVAKLRSDVLINTNPFSEVKYEKHKHNGYSDKVTLDINNKKYD"
CONTIG      join(AEJX01000506.1:1..579)
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.