U.S. flag

An official website of the United States government

Arabidopsis thaliana purple acid phosphatase 8 (PAP8), mRNA

NCBI Reference Sequence: NM_201668.2

FASTA Graphics 

LOCUS       NM_201668               1181 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana purple acid phosphatase 8 (PAP8), mRNA.
ACCESSION   NM_201668
VERSION     NM_201668.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1181)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 1181)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1181)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1181)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003071).
            
            On Apr 18, 2007 this sequence version replaced NM_201668.1.
FEATURES             Location/Qualifiers
     source          1..1181
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gene            1..1181
                     /gene="PAP8"
                     /locus_tag="AT2G01890"
                     /gene_synonym="ATPAP8; purple acid phosphatase 8; PURPLE
                     ACID PHOSPHATASE 8; T23K3.8; T23K3_8"
                     /note="Encodes a purple acid phosphatase (PAP) belonging
                     to the low molecular weight plant PAP group."
                     /db_xref="Araport:AT2G01890"
                     /db_xref="GeneID:814720"
                     /db_xref="TAIR:AT2G01890"
     CDS             41..964
                     /gene="PAP8"
                     /locus_tag="AT2G01890"
                     /gene_synonym="ATPAP8; purple acid phosphatase 8; PURPLE
                     ACID PHOSPHATASE 8; T23K3.8; T23K3_8"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL048526.1,INSD:EH802176.1,INSD:BP627753.1,
                     INSD:BP797414.1,INSD:BP618612.1,INSD:BP802397.1,
                     INSD:AV804832.1,INSD:AV815474.1,INSD:EL171699.1,
                     INSD:EH840366.1,INSD:EL026442.1,INSD:BP618034.1,
                     INSD:EH836107.1,INSD:AA586157.1,INSD:BP644624.1,
                     INSD:EL243367.1,INSD:BP669637.1,INSD:BP606321.1"
                     /inference="similar to RNA sequence, mRNA:INSD:BX820634.1"
                     /note="purple acid phosphatase 8 (PAP8); FUNCTIONS IN:
                     protein serine/threonine phosphatase activity, acid
                     phosphatase activity; INVOLVED IN: dephosphorylation;
                     LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant
                     structures; EXPRESSED DURING: 12 growth stages; CONTAINS
                     InterPro DOMAIN/s: Metallophosphoesterase
                     (InterPro:IPR004843); BEST Arabidopsis thaliana protein
                     match is: purple acid phosphatase 3 (TAIR:AT1G14700.1);
                     Has 35333 Blast hits to 34131 proteins in 2444 species:
                     Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi -
                     991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="purple acid phosphatase 8"
                     /protein_id="NP_973397.1"
                     /db_xref="Araport:AT2G01890"
                     /db_xref="GeneID:814720"
                     /db_xref="TAIR:AT2G01890"
                     /translation="MDSLRDVKPIKLIFSIFCLVIILSACNSTAELPRFVQPPEPDGS
                     LSFLVVGDWGRRGSYNQSQVALQMGKIGKDLNIDFLISTGDNFYDDGIISPYDSQFQD
                     SFTNIYTATSLQKPWYNVLGNHDYREIVDIFFVDTTPFVDRYFDEPKDHVYDWRGVLP
                     RNKYLNSLLTDVDVALQESMAKWKIVVGHHTIKSAGHHGNTIELEKQLLPILEANEVD
                     LYINGHDHCLEHISSINSGIQFMTSGGGSKAWKGDVNDWNPQEMRFYYDGQGFMSVYT
                     SEAELRVVFYDGLGHVLHRWSTLKNGVYSDI"
ORIGIN      
        1 aggtccatca cctcttacat tttttctcca aagtctctca atggatagct tgagagatgt
       61 taagcctatc aaactcatat tttctatttt ctgtctagtt attatactat ccgcctgtaa
      121 ttcaacggca gagctaccgc ggttcgtcca accaccagaa cccgatggtt cactcagttt
      181 tctcgttgtc ggcgactggg gaagaagagg ttcttataat cagtcccaag tagctcttca
      241 gatgggaaaa atagggaagg acttaaatat tgatttcctc atttcgactg gagataactt
      301 ttatgatgat ggaataatca gtccatatga ttctcaattt caagattcgt ttaccaatat
      361 ttacacagca actagcttac aaaaaccatg gtacaatgta ttaggaaatc atgattatag
      421 agagattgtc gatattttct tcgtggatac aacaccgttc gtagatagat attttgatga
      481 accaaaggac catgtatatg attggagagg cgtattaccg agaaataaat accttaacag
      541 tctcttaacg gatgtggatg tggcattgca agaatcaatg gctaaatgga aaatagtggt
      601 aggccatcac acgatcaaaa gtgcaggtca ccacggaaat accatagagc ttgagaaaca
      661 acttttacct atcctcgagg ctaatgaagt ggatctctat ataaacgggc atgatcattg
      721 cttggagcac ataagcagca tcaacagtgg aatacaattt atgacaagtg gaggtggctc
      781 caaggcgtgg aaaggagatg tgaatgattg gaacccacaa gagatgaggt tttactatga
      841 tggacaagga ttcatgtcgg tttacacatc cgaagctgaa ctacgcgtcg ttttctatga
      901 tggtcttggt cacgttttgc atcgatggag cactcttaag aatggggttt attccgatat
      961 ctaatcgatg gtcagacaaa aaagtagtta agagttacga cataattatt tatattaatt
     1021 agtccattgt ttattatgtt gatatttcat gtgagttaaa cattttttaa tgttgtgtga
     1081 ttattttcga attcttaatg gtatcttaat acatggagac atatcttctc atgatttggt
     1141 tttgatttcg tttacattta atatataatt atactgtacg c
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

More about the PAP8 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.