U.S. flag

An official website of the United States government

Arabidopsis thaliana uncharacterized protein (AT2G35736), partial mRNA

NCBI Reference Sequence: NM_129131.1

FASTA Graphics 

LOCUS       NM_129131                171 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana uncharacterized protein (AT2G35736), partial
            mRNA.
ACCESSION   NM_129131
VERSION     NM_129131.1
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 171)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 171)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 171)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 171)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003071).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..171
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gene            <1..>171
                     /locus_tag="AT2G35736"
                     /db_xref="Araport:AT2G35736"
                     /db_xref="GeneID:818145"
                     /db_xref="TAIR:AT2G35736"
     CDS             1..171
                     /locus_tag="AT2G35736"
                     /note="unknown protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown; LOCATED
                     IN: endomembrane system; EXPRESSED IN: 22 plant
                     structures; EXPRESSED DURING: 13 growth stages; BEST
                     Arabidopsis thaliana protein match is: unknown protein
                     (TAIR:AT4G25225.1); Has 78 Blast hits to 78 proteins in 13
                     species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
                     Plants - 78; Viruses - 0; Other Eukaryotes - 0 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_565821.1"
                     /db_xref="Araport:AT2G35736"
                     /db_xref="GeneID:818145"
                     /db_xref="TAIR:AT2G35736"
                     /translation="MGIFRSCFSFITGSVFGVYLAQNYNVPNIRKLTNTGLVVAKHVE
                     ENYRKPKKDDPQ"
ORIGIN      
        1 atgggaatat tcagaagctg cttctctttc ataacgggat cagtttttgg ggtgtacttg
       61 gcacagaact acaacgttcc caatatccgg aagctcacca acaccggcct cgtcgtcgct
      121 aagcacgtgg aagagaacta tcgcaagccc aagaaagacg atccccaatg a
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

More about the AT2G35736 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.