LOCUS NM_129131 171 bp mRNA linear PLN 20-OCT-2022
DEFINITION Arabidopsis thaliana uncharacterized protein (AT2G35736), partial
mRNA.
ACCESSION NM_129131
VERSION NM_129131.1
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 171)
AUTHORS Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
Venter,J.C.
TITLE Sequence and analysis of chromosome 2 of the plant Arabidopsis
thaliana
JOURNAL Nature 402 (6763), 761-768 (1999)
PUBMED 10617197
REFERENCE 2 (bases 1 to 171)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 171)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 171)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
This record is derived from an annotated genomic sequence
(NC_003071).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..171
/organism="Arabidopsis thaliana"
/mol_type="mRNA"
/db_xref="taxon:3702"
/chromosome="2"
/ecotype="Columbia"
gene <1..>171
/locus_tag="AT2G35736"
/db_xref="Araport:AT2G35736"
/db_xref="GeneID:818145"
/db_xref="TAIR:AT2G35736"
CDS 1..171
/locus_tag="AT2G35736"
/note="unknown protein; FUNCTIONS IN: molecular_function
unknown; INVOLVED IN: biological_process unknown; LOCATED
IN: endomembrane system; EXPRESSED IN: 22 plant
structures; EXPRESSED DURING: 13 growth stages; BEST
Arabidopsis thaliana protein match is: unknown protein
(TAIR:AT4G25225.1); Has 78 Blast hits to 78 proteins in 13
species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
Plants - 78; Viruses - 0; Other Eukaryotes - 0 (source:
NCBI BLink)."
/codon_start=1
/product="uncharacterized protein"
/protein_id="NP_565821.1"
/db_xref="Araport:AT2G35736"
/db_xref="GeneID:818145"
/db_xref="TAIR:AT2G35736"
/translation="MGIFRSCFSFITGSVFGVYLAQNYNVPNIRKLTNTGLVVAKHVE
ENYRKPKKDDPQ"
ORIGIN
1 atgggaatat tcagaagctg cttctctttc ataacgggat cagtttttgg ggtgtacttg
61 gcacagaact acaacgttcc caatatccgg aagctcacca acaccggcct cgtcgtcgct
121 aagcacgtgg aagagaacta tcgcaagccc aagaaagacg atccccaatg a
//