LOCUS NM_125733 2060 bp mRNA linear PLN 20-OCT-2022
DEFINITION Arabidopsis thaliana AMP-dependent synthetase and ligase family
protein (AT5G63380), mRNA.
ACCESSION NM_125733
VERSION NM_125733.3
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 2060)
AUTHORS Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
CONSRTM Kazusa DNA Research Institute; Cold Spring Harbor and Washington
University in St Louis Sequencing Consortium; European Union
Arabidopsis Genome Sequencing Consortium
TITLE Sequence and analysis of chromosome 5 of the plant Arabidopsis
thaliana
JOURNAL Nature 408 (6814), 823-826 (2000)
PUBMED 11130714
REFERENCE 2 (bases 1 to 2060)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 2060)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 2060)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
This record is derived from an annotated genomic sequence
(NC_003076).
On Sep 12, 2016 this sequence version replaced NM_125733.2.
FEATURES Location/Qualifiers
source 1..2060
/organism="Arabidopsis thaliana"
/mol_type="mRNA"
/db_xref="taxon:3702"
/chromosome="5"
/ecotype="Columbia"
gene 1..2060
/locus_tag="AT5G63380"
/gene_synonym="K9H21.11; K9H21_11"
/note="Encodes a peroxisomal protein involved in the
activation of fatty acids through esterification with CoA.
At5g63380 preferentially activates fatty acids with
increased chain length (C9:0 to C8:0) and thus shares
characteristics with long-chain fatty acyl-CoA synthases.
Also able to catalyze the conversion of OPDA to its CoA
ester and is therefore thought to be involved in the
peroxisomal beta-oxidation steps of jasmonic acid
biosynthesis."
/db_xref="Araport:AT5G63380"
/db_xref="GeneID:836457"
/db_xref="TAIR:AT5G63380"
CDS 202..1890
/locus_tag="AT5G63380"
/gene_synonym="K9H21.11; K9H21_11"
/inference="Similar to RNA sequence,
EST:INSD:EL181156.1,INSD:EL277641.1,INSD:DR235626.1,
INSD:BP781469.1,INSD:DR235630.1,INSD:EH949522.1,
INSD:EL147765.1,INSD:EL011388.1,INSD:AV527088.1,
INSD:DR375946.1,INSD:EL057329.1,INSD:AV810589.1,
INSD:EL288263.1,INSD:EL205612.1,INSD:AV809888.1,
INSD:EL144133.1,INSD:BP664326.1,INSD:DR235631.1,
INSD:EL154164.1,INSD:BP781934.1,INSD:EH902670.1,
INSD:ES060135.1,INSD:EH821845.1,INSD:EH934944.1,
INSD:AV817533.1,INSD:EH900650.1,INSD:EG520468.1,
INSD:DR235627.1,INSD:DR235629.1,INSD:EL241818.1,
INSD:EL256547.1,INSD:EL168213.1,INSD:EH914099.1,
INSD:EH940857.1,INSD:EL164416.1,INSD:DR235632.1,
INSD:EL004373.1,INSD:DR235628.1,INSD:BP787964.1,
INSD:EL320251.1,INSD:EG520467.1,INSD:DR235633.1,
INSD:EL144649.1,INSD:EL193196.1,INSD:AV830062.1,
INSD:EH979360.1"
/inference="similar to RNA sequence,
mRNA:INSD:AY250835.1,INSD:BX832101.1,INSD:AY376731.1,
INSD:AY136459.1,INSD:BT010394.1"
/note="AMP-dependent synthetase and ligase family protein;
CONTAINS InterPro DOMAIN/s: AMP-binding, conserved site
(InterPro:IPR020845), AMP-dependent synthetase/ligase
(InterPro:IPR000873); BEST Arabidopsis thaliana protein
match is: OPC-8:0 CoA ligase1 (TAIR:AT1G20510.1); Has
81844 Blast hits to 74712 proteins in 3773 species: Archae
- 1219; Bacteria - 53606; Metazoa - 3425; Fungi - 4605;
Plants - 2698; Viruses - 1; Other Eukaryotes - 16290
(source: NCBI BLink)."
/codon_start=1
/product="AMP-dependent synthetase and ligase family
protein"
/protein_id="NP_201143.1"
/db_xref="GeneID:836457"
/db_xref="TAIR:AT5G63380"
/db_xref="Araport:AT5G63380"
/translation="MLTKTNDSRLIDRSSGFDQRTGIYHSLRPSLSLPPIDQPLSAAE
FALSLLLKSSPPATAGKNIEALTYLVNSSSGDNLTYGELLRRVRSLAVSLRERFPSLA
SRNVAFILSPSSLDIPVLYLALMSIGVVVSPANPIGSESEVSHQVEVSEPVIAFATSQ
TVKKLQSSSLPLGTVLMDSTEFLSWLNRSDSSSVNPFQVQVNQSDPAAILFSSGTTGR
VKGVLLTHRNLIASTAVSHQRTLQDPVNYDRVGLFSLPLFHVFGFMMMIRAISLGETL
VLLGRFELEAMFKAVEKYKVTGMPVSPPLIVALVKSELTKKYDLRSLRSLGCGGAPLG
KDIAERFKQKFPDVDIVQGYGLTESSGPAASTFGPEEMVKYGSVGRISENMEAKIVDP
STGESLPPGKTGELWLRGPVIMKGYVGNEKASAETVDKEGWLKTGDLCYFDSEDFLYI
VDRLKELIKYKAYQVPPVELEQILHSNPDVIDAAVVPFPDEDAGEIPMAFIVRKPGSN
LNEAQIIDFVAKQVTPYKKVRRVAFINAIPKNPAGKILRRELTKIAVDGNASKL"
ORIGIN
1 cctttttagt tattttgttt agtagttttg taaacaaaaa acaatataat aaaatcgatt
61 tgccgttaaa aaaaaaaaaa aaacattgat tggtttaggg attgccacgt atgcattaat
121 ttatgtgagt tcatatcttc tcgcaggcgc gcatgttcac cgccgacgaa aagattactg
181 tatctctaat cgtcttccag aatgctgacg aaaaccaacg acagccgttt gattgaccgg
241 agctccggct tcgatcaacg gacaggaatc tatcacagtc ttcgtccctc tctttctcta
301 cctcctatag atcaacctct ctccgccgcc gaattcgcgc tttctctcct actcaaatcc
361 tcaccacctg ccaccgccgg gaaaaacatt gaagccttaa cctacctagt taactcgagc
421 tctggtgata acctcactta tggagagctt cttcgtagag ttcgttctct tgctgtatct
481 ctccgggagc gatttccttc tcttgcctcc agaaatgtcg cttttatcct ctctccttct
541 tcgttggaca taccagtgct ttacttagct ttgatgtcga tcggtgttgt tgtttcaccg
601 gcgaacccaa tcggatctga atcggaggtg agtcatcaag tcgaagtcag tgaaccagta
661 attgcgttcg cgacatcgca gacggttaag aagcttcaat cctcttcttt gcctctcgga
721 actgttctga tggactcgac tgagtttctc tcctggttaa atcgatcgga ttcttcatcg
781 gttaatccat ttcaggttca ggtcaaccaa tcggaccctg ccgctatcct cttttcctct
841 ggaacaaccg ggcgggtcaa aggcgttttg ctcactcacc gtaacctaat cgcctcgacc
901 gccgtatctc accaacggac tctccaagat ccggttaatt acgatcgcgt tggactgttc
961 tcgcttccgc tcttccacgt gtttggtttc atgatgatga ttcgagccat ctcgcttgga
1021 gagacattgg tgcttttagg gagatttgaa ctcgaggcga tgtttaaggc ggtggagaaa
1081 tataaggtta ctggtatgcc tgtatctcct ccgttgattg tagcgttggt caaatcggag
1141 ctcacgaaga agtacgatct ccggtcgttg cgttcccttg gctgcggagg agctccactc
1201 ggcaaagaca tcgcagagag gtttaagcag aaattcccag atgtagatat tgtacagggc
1261 tatggcttga cagagagctc gggaccagct gcctcaacgt ttggacctga agagatggta
1321 aaatatggct cagttggtcg tatctctgag aatatggaag ccaaaattgt tgatccatcc
1381 accggagaat ccttgccacc gggaaaaact ggtgaactct ggctccgagg accagtcatc
1441 atgaaaggtt atgtgggaaa cgagaaagcg agtgcggaga cagtagacaa agaagggtgg
1501 ttaaagactg gtgatctctg ttattttgat tcggaagatt ttctatatat tgttgatcgg
1561 ctaaaggagc taatcaaata caaggcttat caggttccac cggtagagtt ggagcagatt
1621 cttcactcga atccagatgt gattgatgct gcagttgttc cgttccctga cgaggatgca
1681 ggagagattc caatggcttt catagtgaga aaaccaggaa gcaatctcaa cgaagcgcaa
1741 atcattgatt tcgtagctaa acaagttact ccgtacaaga aggtaagacg agttgctttt
1801 ataaatgcaa tcccaaaaaa tcctgctggc aagattctgc gtcgggagct tactaaaatc
1861 gctgtggatg gcaatgcatc aaaactttga gataaccggc tggttcatat attattgtgt
1921 cggttttcag tgaaaatggg atctaattac cggttcagac gaaatgtagc ttacattctt
1981 actacacaag atttaatgta atattgaccg ttcgattaac aacgtgagta ttattattta
2041 tagcatcgtc attcgtcacc
//