U.S. flag

An official website of the United States government

Arabidopsis thaliana AMP-dependent synthetase and ligase family protein (AT5G63380), mRNA

NCBI Reference Sequence: NM_125733.3

FASTA Graphics 

LOCUS       NM_125733               2060 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana AMP-dependent synthetase and ligase family
            protein (AT5G63380), mRNA.
ACCESSION   NM_125733
VERSION     NM_125733.3
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 2060)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 2060)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2060)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 2060)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Sep 12, 2016 this sequence version replaced NM_125733.2.
FEATURES             Location/Qualifiers
     source          1..2060
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..2060
                     /locus_tag="AT5G63380"
                     /gene_synonym="K9H21.11; K9H21_11"
                     /note="Encodes a peroxisomal protein involved in the
                     activation of fatty acids through esterification with CoA.
                     At5g63380 preferentially activates fatty acids with
                     increased chain length (C9:0 to C8:0) and thus shares
                     characteristics with long-chain fatty acyl-CoA synthases.
                     Also able to catalyze the conversion of OPDA to its CoA
                     ester and is therefore thought to be involved in the
                     peroxisomal beta-oxidation steps of jasmonic acid
                     biosynthesis."
                     /db_xref="Araport:AT5G63380"
                     /db_xref="GeneID:836457"
                     /db_xref="TAIR:AT5G63380"
     CDS             202..1890
                     /locus_tag="AT5G63380"
                     /gene_synonym="K9H21.11; K9H21_11"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL181156.1,INSD:EL277641.1,INSD:DR235626.1,
                     INSD:BP781469.1,INSD:DR235630.1,INSD:EH949522.1,
                     INSD:EL147765.1,INSD:EL011388.1,INSD:AV527088.1,
                     INSD:DR375946.1,INSD:EL057329.1,INSD:AV810589.1,
                     INSD:EL288263.1,INSD:EL205612.1,INSD:AV809888.1,
                     INSD:EL144133.1,INSD:BP664326.1,INSD:DR235631.1,
                     INSD:EL154164.1,INSD:BP781934.1,INSD:EH902670.1,
                     INSD:ES060135.1,INSD:EH821845.1,INSD:EH934944.1,
                     INSD:AV817533.1,INSD:EH900650.1,INSD:EG520468.1,
                     INSD:DR235627.1,INSD:DR235629.1,INSD:EL241818.1,
                     INSD:EL256547.1,INSD:EL168213.1,INSD:EH914099.1,
                     INSD:EH940857.1,INSD:EL164416.1,INSD:DR235632.1,
                     INSD:EL004373.1,INSD:DR235628.1,INSD:BP787964.1,
                     INSD:EL320251.1,INSD:EG520467.1,INSD:DR235633.1,
                     INSD:EL144649.1,INSD:EL193196.1,INSD:AV830062.1,
                     INSD:EH979360.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY250835.1,INSD:BX832101.1,INSD:AY376731.1,
                     INSD:AY136459.1,INSD:BT010394.1"
                     /note="AMP-dependent synthetase and ligase family protein;
                     CONTAINS InterPro DOMAIN/s: AMP-binding, conserved site
                     (InterPro:IPR020845), AMP-dependent synthetase/ligase
                     (InterPro:IPR000873); BEST Arabidopsis thaliana protein
                     match is: OPC-8:0 CoA ligase1 (TAIR:AT1G20510.1); Has
                     81844 Blast hits to 74712 proteins in 3773 species: Archae
                     - 1219; Bacteria - 53606; Metazoa - 3425; Fungi - 4605;
                     Plants - 2698; Viruses - 1; Other Eukaryotes - 16290
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="AMP-dependent synthetase and ligase family
                     protein"
                     /protein_id="NP_201143.1"
                     /db_xref="GeneID:836457"
                     /db_xref="TAIR:AT5G63380"
                     /db_xref="Araport:AT5G63380"
                     /translation="MLTKTNDSRLIDRSSGFDQRTGIYHSLRPSLSLPPIDQPLSAAE
                     FALSLLLKSSPPATAGKNIEALTYLVNSSSGDNLTYGELLRRVRSLAVSLRERFPSLA
                     SRNVAFILSPSSLDIPVLYLALMSIGVVVSPANPIGSESEVSHQVEVSEPVIAFATSQ
                     TVKKLQSSSLPLGTVLMDSTEFLSWLNRSDSSSVNPFQVQVNQSDPAAILFSSGTTGR
                     VKGVLLTHRNLIASTAVSHQRTLQDPVNYDRVGLFSLPLFHVFGFMMMIRAISLGETL
                     VLLGRFELEAMFKAVEKYKVTGMPVSPPLIVALVKSELTKKYDLRSLRSLGCGGAPLG
                     KDIAERFKQKFPDVDIVQGYGLTESSGPAASTFGPEEMVKYGSVGRISENMEAKIVDP
                     STGESLPPGKTGELWLRGPVIMKGYVGNEKASAETVDKEGWLKTGDLCYFDSEDFLYI
                     VDRLKELIKYKAYQVPPVELEQILHSNPDVIDAAVVPFPDEDAGEIPMAFIVRKPGSN
                     LNEAQIIDFVAKQVTPYKKVRRVAFINAIPKNPAGKILRRELTKIAVDGNASKL"
ORIGIN      
        1 cctttttagt tattttgttt agtagttttg taaacaaaaa acaatataat aaaatcgatt
       61 tgccgttaaa aaaaaaaaaa aaacattgat tggtttaggg attgccacgt atgcattaat
      121 ttatgtgagt tcatatcttc tcgcaggcgc gcatgttcac cgccgacgaa aagattactg
      181 tatctctaat cgtcttccag aatgctgacg aaaaccaacg acagccgttt gattgaccgg
      241 agctccggct tcgatcaacg gacaggaatc tatcacagtc ttcgtccctc tctttctcta
      301 cctcctatag atcaacctct ctccgccgcc gaattcgcgc tttctctcct actcaaatcc
      361 tcaccacctg ccaccgccgg gaaaaacatt gaagccttaa cctacctagt taactcgagc
      421 tctggtgata acctcactta tggagagctt cttcgtagag ttcgttctct tgctgtatct
      481 ctccgggagc gatttccttc tcttgcctcc agaaatgtcg cttttatcct ctctccttct
      541 tcgttggaca taccagtgct ttacttagct ttgatgtcga tcggtgttgt tgtttcaccg
      601 gcgaacccaa tcggatctga atcggaggtg agtcatcaag tcgaagtcag tgaaccagta
      661 attgcgttcg cgacatcgca gacggttaag aagcttcaat cctcttcttt gcctctcgga
      721 actgttctga tggactcgac tgagtttctc tcctggttaa atcgatcgga ttcttcatcg
      781 gttaatccat ttcaggttca ggtcaaccaa tcggaccctg ccgctatcct cttttcctct
      841 ggaacaaccg ggcgggtcaa aggcgttttg ctcactcacc gtaacctaat cgcctcgacc
      901 gccgtatctc accaacggac tctccaagat ccggttaatt acgatcgcgt tggactgttc
      961 tcgcttccgc tcttccacgt gtttggtttc atgatgatga ttcgagccat ctcgcttgga
     1021 gagacattgg tgcttttagg gagatttgaa ctcgaggcga tgtttaaggc ggtggagaaa
     1081 tataaggtta ctggtatgcc tgtatctcct ccgttgattg tagcgttggt caaatcggag
     1141 ctcacgaaga agtacgatct ccggtcgttg cgttcccttg gctgcggagg agctccactc
     1201 ggcaaagaca tcgcagagag gtttaagcag aaattcccag atgtagatat tgtacagggc
     1261 tatggcttga cagagagctc gggaccagct gcctcaacgt ttggacctga agagatggta
     1321 aaatatggct cagttggtcg tatctctgag aatatggaag ccaaaattgt tgatccatcc
     1381 accggagaat ccttgccacc gggaaaaact ggtgaactct ggctccgagg accagtcatc
     1441 atgaaaggtt atgtgggaaa cgagaaagcg agtgcggaga cagtagacaa agaagggtgg
     1501 ttaaagactg gtgatctctg ttattttgat tcggaagatt ttctatatat tgttgatcgg
     1561 ctaaaggagc taatcaaata caaggcttat caggttccac cggtagagtt ggagcagatt
     1621 cttcactcga atccagatgt gattgatgct gcagttgttc cgttccctga cgaggatgca
     1681 ggagagattc caatggcttt catagtgaga aaaccaggaa gcaatctcaa cgaagcgcaa
     1741 atcattgatt tcgtagctaa acaagttact ccgtacaaga aggtaagacg agttgctttt
     1801 ataaatgcaa tcccaaaaaa tcctgctggc aagattctgc gtcgggagct tactaaaatc
     1861 gctgtggatg gcaatgcatc aaaactttga gataaccggc tggttcatat attattgtgt
     1921 cggttttcag tgaaaatggg atctaattac cggttcagac gaaatgtagc ttacattctt
     1981 actacacaag atttaatgta atattgaccg ttcgattaac aacgtgagta ttattattta
     2041 tagcatcgtc attcgtcacc
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for AMP-dependent synthetase and ligase family protein (NP_201143.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.