U.S. flag

An official website of the United States government

Arabidopsis thaliana uncharacterized protein (AT5G57080), mRNA

NCBI Reference Sequence: NM_125090.2

FASTA Graphics 

LOCUS       NM_125090                495 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana uncharacterized protein (AT5G57080), mRNA.
ACCESSION   NM_125090
VERSION     NM_125090.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 495)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 495)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 495)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 495)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Sep 12, 2016 this sequence version replaced NM_125090.1.
FEATURES             Location/Qualifiers
     source          1..495
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..495
                     /locus_tag="AT5G57080"
                     /gene_synonym="MUL3.2; MUL3_2"
                     /db_xref="Araport:AT5G57080"
                     /db_xref="GeneID:835812"
                     /db_xref="TAIR:AT5G57080"
     CDS             88..276
                     /locus_tag="AT5G57080"
                     /gene_synonym="MUL3.2; MUL3_2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG489739.1,INSD:EG489729.1,INSD:EG459209.1,
                     INSD:EG489734.1,INSD:EG489743.1,INSD:EG489726.1,
                     INSD:EG489732.1,INSD:EG489733.1,INSD:EG459216.1,
                     INSD:EL974168.1,INSD:EG489720.1,INSD:EG489728.1,
                     INSD:EG459212.1,INSD:EG489731.1,INSD:EG459213.1,
                     INSD:EG489742.1,INSD:EG488771.1,INSD:EG459208.1,
                     INSD:EG489725.1,INSD:EG489724.1,INSD:EG488772.1,
                     INSD:EG459214.1,INSD:EG459211.1,INSD:EG488764.1,
                     INSD:EG488766.1,INSD:EG488765.1,INSD:EG489722.1,
                     INSD:EG459210.1,INSD:EG488762.1,INSD:EG489745.1,
                     INSD:EG489740.1,INSD:EG488773.1,INSD:EG459215.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:DQ447083.1,INSD:DQ653375.1"
                     /note="unknown protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown; LOCATED
                     IN: endomembrane system; EXPRESSED IN: 13 plant
                     structures; EXPRESSED DURING: 7 growth stages; BEST
                     Arabidopsis thaliana protein match is: unknown protein
                     (TAIR:AT4G26055.1); Has 14 Blast hits to 14 proteins in 6
                     species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
                     Plants - 14; Viruses - 0; Other Eukaryotes - 0 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_200518.1"
                     /db_xref="GeneID:835812"
                     /db_xref="TAIR:AT5G57080"
                     /db_xref="Araport:AT5G57080"
                     /translation="MKKPYKGKLPTGTPSLAMSTLVVVASLLAGASVVHNIYKPDLSL
                     PPLESSEVAKKDDSVNKV"
ORIGIN      
        1 caaacttgtt gatgatggtt caaaatttcg aaaagctttt caaatttctc ttcatatcgc
       61 gcgctcagtc aaaaagcaga gccaaagatg aagaaaccgt ataaaggaaa gttgccgacg
      121 ggaactccgt ctctggcaat gtcaacactc gtcgtcgttg cttcccttct cgccggagcc
      181 tccgttgtcc acaacatcta caaaccagat ctcagtttac caccgttgga aagtagtgaa
      241 gtggccaaga aggatgattc tgtaaacaaa gtttgaatct ttcaatagtt tcatcctgtt
      301 ttatcaggct acattcactt tggttgttct ctttcaattc atgagttaac aaaaaaacat
      361 ggataaagtt taaaactgag atcacttatt aaaggctttt attcttcttc ctcttgtgaa
      421 gatgtaaaga agaacaaact ctttttaggt ttcttgttgg tcaattcacc gtttttttta
      481 aagagatata agaaa
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for uncharacterized protein AT5G57080 (NP_200518.1).

More about the AT5G57080 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.