LOCUS NM_125090 495 bp mRNA linear PLN 20-OCT-2022
DEFINITION Arabidopsis thaliana uncharacterized protein (AT5G57080), mRNA.
ACCESSION NM_125090
VERSION NM_125090.2
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 495)
AUTHORS Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
CONSRTM Kazusa DNA Research Institute; Cold Spring Harbor and Washington
University in St Louis Sequencing Consortium; European Union
Arabidopsis Genome Sequencing Consortium
TITLE Sequence and analysis of chromosome 5 of the plant Arabidopsis
thaliana
JOURNAL Nature 408 (6814), 823-826 (2000)
PUBMED 11130714
REFERENCE 2 (bases 1 to 495)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 495)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 495)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
This record is derived from an annotated genomic sequence
(NC_003076).
On Sep 12, 2016 this sequence version replaced NM_125090.1.
FEATURES Location/Qualifiers
source 1..495
/organism="Arabidopsis thaliana"
/mol_type="mRNA"
/db_xref="taxon:3702"
/chromosome="5"
/ecotype="Columbia"
gene 1..495
/locus_tag="AT5G57080"
/gene_synonym="MUL3.2; MUL3_2"
/db_xref="Araport:AT5G57080"
/db_xref="GeneID:835812"
/db_xref="TAIR:AT5G57080"
CDS 88..276
/locus_tag="AT5G57080"
/gene_synonym="MUL3.2; MUL3_2"
/inference="Similar to RNA sequence,
EST:INSD:EG489739.1,INSD:EG489729.1,INSD:EG459209.1,
INSD:EG489734.1,INSD:EG489743.1,INSD:EG489726.1,
INSD:EG489732.1,INSD:EG489733.1,INSD:EG459216.1,
INSD:EL974168.1,INSD:EG489720.1,INSD:EG489728.1,
INSD:EG459212.1,INSD:EG489731.1,INSD:EG459213.1,
INSD:EG489742.1,INSD:EG488771.1,INSD:EG459208.1,
INSD:EG489725.1,INSD:EG489724.1,INSD:EG488772.1,
INSD:EG459214.1,INSD:EG459211.1,INSD:EG488764.1,
INSD:EG488766.1,INSD:EG488765.1,INSD:EG489722.1,
INSD:EG459210.1,INSD:EG488762.1,INSD:EG489745.1,
INSD:EG489740.1,INSD:EG488773.1,INSD:EG459215.1"
/inference="similar to RNA sequence,
mRNA:INSD:DQ447083.1,INSD:DQ653375.1"
/note="unknown protein; FUNCTIONS IN: molecular_function
unknown; INVOLVED IN: biological_process unknown; LOCATED
IN: endomembrane system; EXPRESSED IN: 13 plant
structures; EXPRESSED DURING: 7 growth stages; BEST
Arabidopsis thaliana protein match is: unknown protein
(TAIR:AT4G26055.1); Has 14 Blast hits to 14 proteins in 6
species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
Plants - 14; Viruses - 0; Other Eukaryotes - 0 (source:
NCBI BLink)."
/codon_start=1
/product="uncharacterized protein"
/protein_id="NP_200518.1"
/db_xref="GeneID:835812"
/db_xref="TAIR:AT5G57080"
/db_xref="Araport:AT5G57080"
/translation="MKKPYKGKLPTGTPSLAMSTLVVVASLLAGASVVHNIYKPDLSL
PPLESSEVAKKDDSVNKV"
ORIGIN
1 caaacttgtt gatgatggtt caaaatttcg aaaagctttt caaatttctc ttcatatcgc
61 gcgctcagtc aaaaagcaga gccaaagatg aagaaaccgt ataaaggaaa gttgccgacg
121 ggaactccgt ctctggcaat gtcaacactc gtcgtcgttg cttcccttct cgccggagcc
181 tccgttgtcc acaacatcta caaaccagat ctcagtttac caccgttgga aagtagtgaa
241 gtggccaaga aggatgattc tgtaaacaaa gtttgaatct ttcaatagtt tcatcctgtt
301 ttatcaggct acattcactt tggttgttct ctttcaattc atgagttaac aaaaaaacat
361 ggataaagtt taaaactgag atcacttatt aaaggctttt attcttcttc ctcttgtgaa
421 gatgtaaaga agaacaaact ctttttaggt ttcttgttgg tcaattcacc gtttttttta
481 aagagatata agaaa
//