U.S. flag

An official website of the United States government

Arabidopsis thaliana RING/U-box superfamily protein (AT5G42200), mRNA

NCBI Reference Sequence: NM_123585.4

FASTA Graphics 

LOCUS       NM_123585               1005 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana RING/U-box superfamily protein (AT5G42200),
            mRNA.
ACCESSION   NM_123585
VERSION     NM_123585.4
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1005)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 1005)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1005)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1005)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Sep 12, 2016 this sequence version replaced NM_123585.3.
FEATURES             Location/Qualifiers
     source          1..1005
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..1005
                     /locus_tag="AT5G42200"
                     /gene_synonym="MJC20.31; MJC20_31"
                     /db_xref="Araport:AT5G42200"
                     /db_xref="GeneID:834225"
                     /db_xref="TAIR:AT5G42200"
     CDS             238..729
                     /locus_tag="AT5G42200"
                     /gene_synonym="MJC20.31; MJC20_31"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR323139.1,INSD:EH906320.1,INSD:DR370688.1,
                     INSD:EH908154.1,INSD:DR323178.1,INSD:AI993818.1,
                     INSD:EL292113.1,INSD:EH847484.1,INSD:EG438796.1,
                     INSD:EH907914.1,INSD:EH975086.1,INSD:EH966107.1,
                     INSD:DR323138.1,INSD:N97143.1,INSD:EL318732.1,
                     INSD:AA650778.1,INSD:AU227638.1,INSD:EL047322.1,
                     INSD:AA394863.1,INSD:EH948876.1,INSD:EL120180.1,
                     INSD:EH989291.1,INSD:EL293820.1,INSD:EH823097.1,
                     INSD:EL175387.1,INSD:EG518819.1,INSD:EG438793.1,
                     INSD:EL223308.1,INSD:EH862248.1,INSD:EG438790.1,
                     INSD:AU236679.1,INSD:EL300277.1,INSD:EL150926.1,
                     INSD:EH859642.1,INSD:DR323179.1,INSD:BE523922.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT003837.1,INSD:BT005191.1,INSD:AY088186.1,
                     INSD:BX832997.1"
                     /note="RING/U-box superfamily protein; CONTAINS InterPro
                     DOMAIN/s: Zinc finger, RING-type (InterPro:IPR001841),
                     Zinc finger, C3HC4 RING-type (InterPro:IPR018957); BEST
                     Arabidopsis thaliana protein match is: RING/U-box
                     superfamily protein (TAIR:AT1G49220.1); Has 1807 Blast
                     hits to 1807 proteins in 277 species: Archae - 0; Bacteria
                     - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses -
                     0; Other Eukaryotes - 339 (source: NCBI BLink)."
                     /codon_start=1
                     /product="RING/U-box superfamily protein"
                     /protein_id="NP_199035.1"
                     /db_xref="GeneID:834225"
                     /db_xref="TAIR:AT5G42200"
                     /db_xref="Araport:AT5G42200"
                     /translation="MHYTRISPALVPSLSPTAAAESSGGGTMIATVFMALLLPCVGMC
                     IVFLIYLFLLWCSTRRRIERLRFAEPVKPVTGKGLSVLELEKIPKLTGRELAVIARST
                     ECAVCLEDIESGQSTRLVPGCNHGFHQLCADTWLSNHTVCPVCRAELAPNLPQCNENQ
                     SPC"
ORIGIN      
        1 cgaaaagaaa caaaatcata acaataatag tttaacctaa accctgatat ttggctctac
       61 cgtgtcctag cctctcctct ttgtataaat agccgttact ctttttcaca tgattttcac
      121 taccaacaac acttagagaa caagcagagg aatataactt tttttttctt tttccttttt
      181 gcttttttac aaccaaaaaa ataaagcaag ccgtagagag caagagacgg tgtaaagatg
      241 cactacacac gcatctcgcc ggctttagta ccatctctat caccaaccgc cgcggctgaa
      301 tctagcggtg gtgggacgat gatagctact gttttcatgg cccttctcct cccctgcgtc
      361 ggcatgtgca tcgtcttcct aatctatcta ttcctcttgt ggtgctccac acggcgtcgt
      421 atcgaacgcc ttcgatttgc tgaaccggtt aaaccggtca caggtaaagg cctttcggtg
      481 ttggagctcg agaaaatccc taaactcacc ggaagagagc tagccgtaat agctagatca
      541 acggaatgtg ctgtttgcct tgaagatata gagagtggtc aatcgactcg tctagttccc
      601 ggttgcaacc atgggtttca ccaattatgt gctgatacgt ggctatctaa ccacacggtt
      661 tgtccagttt gccgcgccga gctggctccg aacctacctc aatgtaatga aaatcaaagt
      721 ccatgttaga aacagaattt tcaaaaacat tctttccttc ttttttactc gttttgtgta
      781 cttctcttgt ttttcccttt tcttagtttt gtgtaagcgt tatagagaga gaagtttcca
      841 ggttgtaact agccttgttg tttttttttg tacatgaaat tagttttaga gtaaattacg
      901 aaatttacag ttatgtcatt gtatttacaa caatttttct tcaaccatta caataagtat
      961 atcaatgata gagttaaact ttgggtccaa caaaaaataa ataaa
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

More about the AT5G42200 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.