U.S. flag

An official website of the United States government

Arabidopsis thaliana uncharacterized protein (AT5G01790), mRNA

NCBI Reference Sequence: NM_120257.5

FASTA Graphics 

LOCUS       NM_120257               1236 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana uncharacterized protein (AT5G01790), mRNA.
ACCESSION   NM_120257
VERSION     NM_120257.5
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1236)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 1236)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1236)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1236)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Sep 12, 2016 this sequence version replaced NM_120257.4.
FEATURES             Location/Qualifiers
     source          1..1236
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..1236
                     /locus_tag="AT5G01790"
                     /gene_synonym="T20L15.60; T20L15_60"
                     /db_xref="Araport:AT5G01790"
                     /db_xref="GeneID:831868"
                     /db_xref="TAIR:AT5G01790"
     CDS             230..856
                     /locus_tag="AT5G01790"
                     /gene_synonym="T20L15.60; T20L15_60"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EG516967.1,INSD:ES052854.1,INSD:ES087009.1,
                     INSD:ES152420.1,INSD:AV556068.1,INSD:DR382885.1,
                     INSD:DR358030.1,INSD:ES165735.1,INSD:EL969275.1,
                     INSD:ES046949.1,INSD:ES151941.1,INSD:AV567657.1,
                     INSD:T03962.1,INSD:EG516966.1,INSD:EL986476.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT010833.1,INSD:BX833131.1,INSD:BX833182.1,
                     INSD:BT011294.1,INSD:BT015487.1,INSD:BX833276.1,
                     INSD:BX833153.1"
                     /note="unknown protein; FUNCTIONS IN: molecular_function
                     unknown; INVOLVED IN: biological_process unknown; LOCATED
                     IN: chloroplast; EXPRESSED IN: 19 plant structures;
                     EXPRESSED DURING: 13 growth stages; Has 121 Blast hits to
                     121 proteins in 12 species: Archae - 0; Bacteria - 0;
                     Metazoa - 0; Fungi - 0; Plants - 121; Viruses - 0; Other
                     Eukaryotes - 0 (source: NCBI BLink)."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_195799.2"
                     /db_xref="GeneID:831868"
                     /db_xref="TAIR:AT5G01790"
                     /db_xref="Araport:AT5G01790"
                     /translation="MHTSLPLFPSLSLSHSPKTIMPNAGSERAASLSLKKQDTATFSG
                     KLPSTKQRFSSVSAACPSFRIYYYDGAAGAVPFEWESHPGTPKHPSSELPTLPPLTPP
                     PSHFSFSGDQIRRRSKKSTKKILALIPTRLFWLSGDHNGKAKKLSASSPPSLSERVLI
                     DENEYDLFKFQTERNVMRRFSSFDSSADYPIQRSQSTSCFGIRRCFLC"
ORIGIN      
        1 tgtaggattg gaccaacaca cttcgagatg tatctttata agttctaact atgagagcta
       61 attaaccgca ctattgaaac tattatttca ctatcattaa ttattacatt ttgcttttaa
      121 tatatagttt ctatagacac caaagccaaa caaataagcc caaaagtaaa aaccgtacca
      181 aagacaccag gcacccatat atacatgata gattgactcc atatgtctca tgcacacatc
      241 tctccctctc tttccttccc tctctctctc tcactctccc aagacaataa tgccaaacgc
      301 gggatctgag cgggcagctt cactctcact gaaaaagcaa gacaccgcca ccttctccgg
      361 taagctaccg tcgaccaaac aacgtttttc gtcggtatca gctgcttgtc cttcctttag
      421 aatctactac tacgacggag ccgccggtgc cgtccctttc gaatgggaat ctcatccagg
      481 cacacccaaa cacccctcct ctgagctacc tactctgcca cctctcactc ctccgccgtc
      541 tcatttctct ttctccggcg accaaatccg ccgccgttcc aaaaagtcca ccaagaaaat
      601 cctcgcacta atcccgacaa ggctcttctg gctatcgggc gatcacaatg gtaaggctaa
      661 gaaactgtcg gcttcatcac caccatctct gtcggagaga gtgttgatcg acgaaaatga
      721 gtacgatctg ttcaagtttc aaacagaaag gaatgtcatg cgaagatttt catccttcga
      781 ctcttctgct gactacccaa ttcagagatc acaatccact tcctgcttcg gaatccgcag
      841 atgtttcctc tgctaattcc gctgcaaaat ttggaaaata aaacgttgaa attttataaa
      901 atgtttttca tatattagtt tattttgtgt tccatcgtct tattattata atatttaatc
      961 agtttgtgtc ggtaatgcaa ctccgaatca tataatacgt ttaccttttt gttaaataag
     1021 agcaatgaac agttacaaga gttacgtaaa ttgatcagaa gattattata gtaactgtcg
     1081 cattcacttt ggtttaaagt gcatgactaa aactttgata atttaagtat agcttttggc
     1141 aagtgtgtct ttttgtatat ggatggttcc gtgtaaaaat gtaactgtga gtttgaacaa
     1201 gccttctttg gtgttaattt agctgtcttc caagca
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for uncharacterized protein AT5G01790 (NP_195799.2).

More about the AT5G01790 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.