U.S. flag

An official website of the United States government

Arabidopsis thaliana Galactose oxidase/kelch repeat superfamily protein (AT4G39240), mRNA

NCBI Reference Sequence: NM_120085.4

FASTA Graphics 

LOCUS       NM_120085               1457 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana Galactose oxidase/kelch repeat superfamily
            protein (AT4G39240), mRNA.
ACCESSION   NM_120085
VERSION     NM_120085.4
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1457)
  AUTHORS   Mayer,K., Schuller,C., Wambutt,R., Murphy,G., Volckaert,G.,
            Pohl,T., Dusterhoft,A., Stiekema,W., Entian,K.D., Terryn,N.,
            Harris,B., Ansorge,W., Brandt,P., Grivell,L., Rieger,M.,
            Weichselgartner,M., de Simone,V., Obermaier,B., Mache,R.,
            Muller,M., Kreis,M., Delseny,M., Puigdomenech,P., Watson,M.,
            Schmidtheini,T., Reichert,B., Portatelle,D., Perez-Alonso,M.,
            Boutry,M., Bancroft,I., Vos,P., Hoheisel,J., Zimmermann,W.,
            Wedler,H., Ridley,P., Langham,S.A., McCullagh,B., Bilham,L.,
            Robben,J., Van der Schueren,J., Grymonprez,B., Chuang,Y.J.,
            Vandenbussche,F., Braeken,M., Weltjens,I., Voet,M., Bastiaens,I.,
            Aert,R., Defoor,E., Weitzenegger,T., Bothe,G., Ramsperger,U.,
            Hilbert,H., Braun,M., Holzer,E., Brandt,A., Peters,S., van
            Staveren,M., Dirske,W., Mooijman,P., Klein Lankhorst,R., Rose,M.,
            Hauf,J., Kotter,P., Berneiser,S., Hempel,S., Feldpausch,M.,
            Lamberth,S., Van den Daele,H., De Keyser,A., Buysshaert,C.,
            Gielen,J., Villarroel,R., De Clercq,R., Van Montagu,M., Rogers,J.,
            Cronin,A., Quail,M., Bray-Allen,S., Clark,L., Doggett,J., Hall,S.,
            Kay,M., Lennard,N., McLay,K., Mayes,R., Pettett,A.,
            Rajandream,M.A., Lyne,M., Benes,V., Rechmann,S., Borkova,D.,
            Blocker,H., Scharfe,M., Grimm,M., Lohnert,T.H., Dose,S., de
            Haan,M., Maarse,A., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M.,
            Fartmann,B., Granderath,K., Dauner,D., Herzl,A., Neumann,S.,
            Argiriou,A., Vitale,D., Liguori,R., Piravandi,E., Massenet,O.,
            Quigley,F., Clabauld,G., Mundlein,A., Felber,R., Schnabl,S.,
            Hiller,R., Schmidt,W., Lecharny,A., Aubourg,S., Chefdor,F.,
            Cooke,R., Berger,C., Montfort,A., Casacuberta,E., Gibbons,T.,
            Weber,N., Vandenbol,M., Bargues,M., Terol,J., Torres,A.,
            Perez-Perez,A., Purnelle,B., Bent,E., Johnson,S., Tacon,D.,
            Jesse,T., Heijnen,L., Schwarz,S., Scholler,P., Heber,S., Francs,P.,
            Bielke,C., Frishman,D., Haase,D., Lemcke,K., Mewes,H.W.,
            Stocker,S., Zaccaria,P., Bevan,M., Wilson,R.K., de la Bastide,M.,
            Habermann,K., Parnell,L., Dedhia,N., Gnoj,L., Schutz,K., Huang,E.,
            Spiegel,L., Sehkon,M., Murray,J., Sheet,P., Cordes,M.,
            Abu-Threideh,J., Stoneking,T., Kalicki,J., Graves,T., Harmon,G.,
            Edwards,J., Latreille,P., Courtney,L., Cloud,J., Abbott,A.,
            Scott,K., Johnson,D., Minx,P., Bentley,D., Fulton,B., Miller,N.,
            Greco,T., Kemp,K., Kramer,J., Fulton,L., Mardis,E., Dante,M.,
            Pepin,K., Hillier,L., Nelson,J., Spieth,J., Ryan,E., Andrews,S.,
            Geisel,C., Layman,D., Du,H., Ali,J., Berghoff,A., Jones,K.,
            Drone,K., Cotton,M., Joshu,C., Antonoiu,B., Zidanic,M., Strong,C.,
            Sun,H., Lamar,B., Yordan,C., Ma,P., Zhong,J., Preston,R., Vil,D.,
            Shekher,M., Matero,A., Shah,R., Swaby,I.K., O'Shaughnessy,A.,
            Rodriguez,M., Hoffmann,J., Till,S., Granat,S., Shohdy,N.,
            Hasegawa,A., Hameed,A., Lodhi,M., Johnson,A., Chen,E., Marra,M.,
            Martienssen,R. and McCombie,W.R.
  TITLE     Sequence and analysis of chromosome 4 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 769-777 (1999)
   PUBMED   10617198
REFERENCE   2  (bases 1 to 1457)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1457)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1457)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003075).
            
            On Apr 18, 2007 this sequence version replaced NM_120085.3.
FEATURES             Location/Qualifiers
     source          1..1457
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="4"
                     /ecotype="Columbia"
     gene            1..1457
                     /locus_tag="AT4G39240"
                     /gene_synonym="T22F8.140; T22F8_140"
                     /db_xref="Araport:AT4G39240"
                     /db_xref="GeneID:830080"
                     /db_xref="TAIR:AT4G39240"
     CDS             62..1189
                     /locus_tag="AT4G39240"
                     /gene_synonym="T22F8.140; T22F8_140"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES064868.1,INSD:AV828566.1,INSD:EG441420.1,
                     INSD:EL020344.1,INSD:CB265023.1,INSD:EH924708.1,
                     INSD:BP583254.1,INSD:BE529182.1,INSD:BP587098.1,
                     INSD:BP593124.1,INSD:ES061610.1,INSD:BP868423.1,
                     INSD:BP854807.1,INSD:BP576884.1,INSD:EL208264.1,
                     INSD:BP658831.1,INSD:T22870.1,INSD:BP590175.1,
                     INSD:EL026610.1,INSD:ES157970.1,INSD:ES073153.1,
                     INSD:EH960677.1,INSD:AV819629.1,INSD:BP565248.1,
                     INSD:BP831955.1,INSD:BP579944.1,INSD:AV819418.1,
                     INSD:ES209124.1,INSD:AV442228.1,INSD:EL102301.1,
                     INSD:BP815652.1,INSD:DR285467.1,INSD:BP817385.1,
                     INSD:EL009308.1,INSD:AV820911.1,INSD:EH830548.1,
                     INSD:DR254821.1,INSD:DR235484.1,INSD:EH868729.1,
                     INSD:ES102645.1,INSD:AV807246.1,INSD:ES111228.1,
                     INSD:BX840857.1,INSD:BP789927.1,INSD:ES206912.1,
                     INSD:BP585978.1,INSD:BP577994.1,INSD:EL987475.1,
                     INSD:ES088136.1,INSD:ES060007.1,INSD:ES090253.1,
                     INSD:AV820783.1,INSD:AV801863.1,INSD:BP649164.1,
                     INSD:BP624201.1,INSD:BP614995.1,INSD:BP656760.1,
                     INSD:AV832163.1,INSD:CF652378.1,INSD:EL118597.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX829204.1,INSD:AY128921.1,INSD:BX828675.1,
                     INSD:BX828110.1,INSD:AF370467.1"
                     /note="Galactose oxidase/kelch repeat superfamily protein;
                     CONTAINS InterPro DOMAIN/s: F-box domain, cyclin-like
                     (InterPro:IPR001810), Galactose oxidase/kelch,
                     beta-propeller (InterPro:IPR011043), Kelch repeat type 1
                     (InterPro:IPR006652), Kelch related (InterPro:IPR013089),
                     Kelch-type beta propeller (InterPro:IPR015915); BEST
                     Arabidopsis thaliana protein match is: Galactose
                     oxidase/kelch repeat superfamily protein
                     (TAIR:AT4G14905.2); Has 1894 Blast hits to 1751 proteins
                     in 120 species: Archae - 10; Bacteria - 133; Metazoa -
                     685; Fungi - 4; Plants - 1024; Viruses - 7; Other
                     Eukaryotes - 31 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Galactose oxidase/kelch repeat superfamily
                     protein"
                     /protein_id="NP_195635.1"
                     /db_xref="GeneID:830080"
                     /db_xref="TAIR:AT4G39240"
                     /db_xref="Araport:AT4G39240"
                     /translation="MPFSAASSSSVSSIAEEPPPKKQHDPSPSCSSYLLLLPDEIILN
                     CLARLPKCYYPVISLVSKTFRRLIASPEIYVERSLLRRTERVLYVVLRSHATETPRWY
                     TLNFKPFGNDSNNHRLVPIPSFPSIPCWGMSIVAIDSEIYVLGGCIDNELVSTGFVVE
                     CPSHTCRLLPSMKQARGCAAVGFFDGKLYVIGGCNPLSVNWVEAFDLKTQTWESGLGV
                     NNVEMHDLTIRSFAIDDKIYIMDRKNSFVYDPKEGTLETDELLDTQWSVGSCVIDGKI
                     YTFGSKNRIWVFDPIAMVWDRLKGLDDLPDKRDGSRMSNLGGNLAIMFNLEKGSTKIC
                     CTEIRLERREGGKIWGTVLWSNIVITLKEPSTIVRCLTVTV"
ORIGIN      
        1 tgatgatcgg ttttgttcat ttgcaacttt tgactaaaaa aagcagctca tagcagcggt
       61 tatgcctttt tccgccgcga gttcgagctc cgtaagctca atcgctgaag aaccgccgcc
      121 aaagaaacag catgatccat cgccgtcctg ttcatcgtat ctgttactac ttccagacga
      181 aatcattctg aattgcttag cacgcttgcc gaaatgttac tacccggtga tttcactcgt
      241 ctccaagacc tttaggcgtc tcatagcttc accggagatc tacgttgaaa ggtcattact
      301 tcgccgcacc gagcgtgtcc tttatgttgt gcttagatct cacgctacag aaactccccg
      361 atggtacact ctcaatttca aaccctttgg aaatgattca aataaccata gattggttcc
      421 gattccgtcg tttccttcga ttccttgctg gggaatgtca attgtcgcta ttgattctga
      481 aatttacgtc cttggtggat gcattgataa tgaattggtc tccactgggt ttgtcgtcga
      541 atgtccatct cacacgtgtc gtctcctccc tagcatgaag caggcacgtg gctgcgccgc
      601 cgtgggattt tttgatggga aattgtatgt aatcggaggt tgtaaccctc tgtctgtgaa
      661 ttgggtagag gcttttgatc taaagactca aacttgggag tctggtttgg gtgttaataa
      721 tgtggaaatg catgacttaa ccatcagaag ttttgcgata gatgataaga tttacattat
      781 ggatcgaaag aatagctttg tttatgatcc taaagaaggt acgttggaga ctgatgagtt
      841 gttggacaca caatggagtg ttggttcttg cgtcattgat ggaaagattt acacttttgg
      901 tagcaagaat agaatatggg tgtttgatcc aattgccatg gtttgggatc gcttgaaggg
      961 tctcgacgat cttcctgaca agcgtgatgg ctcgagaatg tcgaatctcg ggggaaatct
     1021 tgcgattatg tttaaccttg agaagggttc aaccaaaatc tgttgcacgg agatcagatt
     1081 ggaaaggagg gaaggaggaa agatttgggg gacggtcctg tggtctaata ttgtcattac
     1141 cttgaaagaa ccttccacca ttgtacgatg tctaactgta acagtttgat aaagcttcaa
     1201 gcttgaaaat catatctgta aacgtgtacc ggagcagctt gttctgttca agatgaaaca
     1261 aacaacatac gaggctttat tggatattgg tatccagaac ctaatataga tatcttttgg
     1321 aactttgggc taagttatgc aatatatttc tcttgtttct ttgttgtacg actcttatgt
     1381 atgcaagtat attgtatgat taatagaaac tatgttacca gctgtttgtt taacaaagat
     1441 caaaccaata acatttg
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for Galactose oxidase/kelch repeat superfamily protein (NP_195635.1).

More about the AT4G39240 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.