U.S. flag

An official website of the United States government

Arabidopsis thaliana indole-3-acetic acid 6 (IAA6), mRNA

NCBI Reference Sequence: NM_104161.3

FASTA Graphics 

LOCUS       NM_104161                857 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana indole-3-acetic acid 6 (IAA6), mRNA.
ACCESSION   NM_104161
VERSION     NM_104161.3
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 857)
  AUTHORS   Theologis,A., Ecker,J.R., Palm,C.J., Federspiel,N.A., Kaul,S.,
            White,O., Alonso,J., Altafi,H., Araujo,R., Bowman,C.L.,
            Brooks,S.Y., Buehler,E., Chan,A., Chao,Q., Chen,H., Cheuk,R.F.,
            Chin,C.W., Chung,M.K., Conn,L., Conway,A.B., Conway,A.R.,
            Creasy,T.H., Dewar,K., Dunn,P., Etgu,P., Feldblyum,T.V., Feng,J.,
            Fong,B., Fujii,C.Y., Gill,J.E., Goldsmith,A.D., Haas,B.,
            Hansen,N.F., Hughes,B., Huizar,L., Hunter,J.L., Jenkins,J.,
            Johnson-Hopson,C., Khan,S., Khaykin,E., Kim,C.J., Koo,H.L.,
            Kremenetskaia,I., Kurtz,D.B., Kwan,A., Lam,B., Langin-Hooper,S.,
            Lee,A., Lee,J.M., Lenz,C.A., Li,J.H., Li,Y., Lin,X., Liu,S.X.,
            Liu,Z.A., Luros,J.S., Maiti,R., Marziali,A., Militscher,J.,
            Miranda,M., Nguyen,M., Nierman,W.C., Osborne,B.I., Pai,G.,
            Peterson,J., Pham,P.K., Rizzo,M., Rooney,T., Rowley,D., Sakano,H.,
            Salzberg,S.L., Schwartz,J.R., Shinn,P., Southwick,A.M., Sun,H.,
            Tallon,L.J., Tambunga,G., Toriumi,M.J., Town,C.D., Utterback,T.,
            Van Aken,S., Vaysberg,M., Vysotskaia,V.S., Walker,M., Wu,D., Yu,G.,
            Fraser,C.M., Venter,J.C. and Davis,R.W.
  TITLE     Sequence and analysis of chromosome 1 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 816-820 (2000)
   PUBMED   11130712
REFERENCE   2  (bases 1 to 857)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 857)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-2017) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 857)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   5  (bases 1 to 857)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003070).
            
            On Sep 12, 2016 this sequence version replaced NM_104161.2.
FEATURES             Location/Qualifiers
     source          1..857
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="1"
                     /ecotype="Columbia"
     gene            1..857
                     /gene="IAA6"
                     /locus_tag="AT1G52830"
                     /gene_synonym="F14G24.10; F14G24_10; indole-3-acetic acid
                     6; SHORT HYPOCOTYL 1; SHY1"
                     /note="An extragenic dominant suppressor of the hy2 mutant
                     phenotype. Also exhibits aspects of constitutive
                     photomorphogenetic phenotype in the absence of hy2.
                     Mutants have dominant leaf curling phenotype shortened
                     hypocotyls and reduced apical hook. Induced by
                     indole-3-acetic acid."
                     /db_xref="Araport:AT1G52830"
                     /db_xref="GeneID:841717"
                     /db_xref="TAIR:AT1G52830"
     CDS             94..663
                     /gene="IAA6"
                     /locus_tag="AT1G52830"
                     /gene_synonym="F14G24.10; F14G24_10; indole-3-acetic acid
                     6; SHORT HYPOCOTYL 1; SHY1"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR380840.1,INSD:DR251789.1,INSD:DR251788.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BX817970.1,INSD:AF336915.1,INSD:AY085353.1,
                     INSD:U18408.1"
                     /note="indole-3-acetic acid 6 (IAA6); CONTAINS InterPro
                     DOMAIN/s: Aux/IAA-ARF-dimerisation (InterPro:IPR011525),
                     AUX/IAA protein (InterPro:IPR003311); BEST Arabidopsis
                     thaliana protein match is: indole-3-acetic acid inducible
                     19 (TAIR:AT3G15540.1); Has 1737 Blast hits to 1736
                     proteins in 78 species: Archae - 0; Bacteria - 0; Metazoa
                     - 0; Fungi - 0; Plants - 1736; Viruses - 0; Other
                     Eukaryotes - 1 (source: NCBI BLink)."
                     /codon_start=1
                     /product="indole-3-acetic acid 6"
                     /protein_id="NP_175692.1"
                     /db_xref="Araport:AT1G52830"
                     /db_xref="GeneID:841717"
                     /db_xref="TAIR:AT1G52830"
                     /translation="MAKEGLALEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTS
                     SALDTENENSVVSSVEDESLPVVKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDG
                     VPYMRKIDLGSSNSYINLVTVLENLFGCLGIGVAKEGKKCEYIIIYEDKDRDWMLVGD
                     VPWQMFKESCKRLRIVKRSDATGFGLQQD"
ORIGIN      
        1 atcattccaa caagagaagt gcttgagaga aaaaaaaagt atcaaaactt catatagcca
       61 aatttaaaca aaaagaaaaa agagaagaaa taaatggcaa aggaaggtct agcactcgag
      121 atcacagagc ttcgattggg tcttccagga gataattata gcgaaatatc agtatgcgga
      181 tcgagtaaga agaagaagag ggtgctctcg gatatgatga cctcatcagc gttagatact
      241 gagaatgaaa acagcgtcgt ttcatcagtt gaagatgaat cactgccggt tgtgaagagt
      301 caagcggtgg gatggccacc tgtgtgttct tacaggagaa agaagaacaa tgaggaagca
      361 tcgaaagcta taggctacgt gaaagtgagc atggatggtg tgccatacat gaggaagatt
      421 gaccttggtt cgagcaacag ttatattaat ctagtcacgg ttcttgagaa tctcttcggc
      481 tgtcttggca taggagtggc gaaggagggt aagaagtgtg aatacattat tatatacgaa
      541 gacaaggata gagactggat gctcgtcgga gatgtacctt ggcagatgtt taaagaatca
      601 tgcaagaggc tgaggatcgt gaagagatca gatgcaactg gttttggtct ccagcaagat
      661 taatcatact agctagtgtt gatcatcttt aattaaccat aaagtttgaa aaccgttgag
      721 taattttttt tcattataat catttttcaa attgtaaaat ttatatgata atgatgatat
      781 atacgttttc ttcaaatgta tttccttact ggtcgtatca tactttaatg ttttatggct
      841 cattaaaggt gtttctt
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.