LOCUS NM_104161 857 bp mRNA linear PLN 20-OCT-2022
DEFINITION Arabidopsis thaliana indole-3-acetic acid 6 (IAA6), mRNA.
ACCESSION NM_104161
VERSION NM_104161.3
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 857)
AUTHORS Theologis,A., Ecker,J.R., Palm,C.J., Federspiel,N.A., Kaul,S.,
White,O., Alonso,J., Altafi,H., Araujo,R., Bowman,C.L.,
Brooks,S.Y., Buehler,E., Chan,A., Chao,Q., Chen,H., Cheuk,R.F.,
Chin,C.W., Chung,M.K., Conn,L., Conway,A.B., Conway,A.R.,
Creasy,T.H., Dewar,K., Dunn,P., Etgu,P., Feldblyum,T.V., Feng,J.,
Fong,B., Fujii,C.Y., Gill,J.E., Goldsmith,A.D., Haas,B.,
Hansen,N.F., Hughes,B., Huizar,L., Hunter,J.L., Jenkins,J.,
Johnson-Hopson,C., Khan,S., Khaykin,E., Kim,C.J., Koo,H.L.,
Kremenetskaia,I., Kurtz,D.B., Kwan,A., Lam,B., Langin-Hooper,S.,
Lee,A., Lee,J.M., Lenz,C.A., Li,J.H., Li,Y., Lin,X., Liu,S.X.,
Liu,Z.A., Luros,J.S., Maiti,R., Marziali,A., Militscher,J.,
Miranda,M., Nguyen,M., Nierman,W.C., Osborne,B.I., Pai,G.,
Peterson,J., Pham,P.K., Rizzo,M., Rooney,T., Rowley,D., Sakano,H.,
Salzberg,S.L., Schwartz,J.R., Shinn,P., Southwick,A.M., Sun,H.,
Tallon,L.J., Tambunga,G., Toriumi,M.J., Town,C.D., Utterback,T.,
Van Aken,S., Vaysberg,M., Vysotskaia,V.S., Walker,M., Wu,D., Yu,G.,
Fraser,C.M., Venter,J.C. and Davis,R.W.
TITLE Sequence and analysis of chromosome 1 of the plant Arabidopsis
thaliana
JOURNAL Nature 408 (6814), 816-820 (2000)
PUBMED 11130712
REFERENCE 2 (bases 1 to 857)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 857)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (18-JUL-2017) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 857)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 5 (bases 1 to 857)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
This record is derived from an annotated genomic sequence
(NC_003070).
On Sep 12, 2016 this sequence version replaced NM_104161.2.
FEATURES Location/Qualifiers
source 1..857
/organism="Arabidopsis thaliana"
/mol_type="mRNA"
/db_xref="taxon:3702"
/chromosome="1"
/ecotype="Columbia"
gene 1..857
/gene="IAA6"
/locus_tag="AT1G52830"
/gene_synonym="F14G24.10; F14G24_10; indole-3-acetic acid
6; SHORT HYPOCOTYL 1; SHY1"
/note="An extragenic dominant suppressor of the hy2 mutant
phenotype. Also exhibits aspects of constitutive
photomorphogenetic phenotype in the absence of hy2.
Mutants have dominant leaf curling phenotype shortened
hypocotyls and reduced apical hook. Induced by
indole-3-acetic acid."
/db_xref="Araport:AT1G52830"
/db_xref="GeneID:841717"
/db_xref="TAIR:AT1G52830"
CDS 94..663
/gene="IAA6"
/locus_tag="AT1G52830"
/gene_synonym="F14G24.10; F14G24_10; indole-3-acetic acid
6; SHORT HYPOCOTYL 1; SHY1"
/inference="Similar to RNA sequence,
EST:INSD:DR380840.1,INSD:DR251789.1,INSD:DR251788.1"
/inference="similar to RNA sequence,
mRNA:INSD:BX817970.1,INSD:AF336915.1,INSD:AY085353.1,
INSD:U18408.1"
/note="indole-3-acetic acid 6 (IAA6); CONTAINS InterPro
DOMAIN/s: Aux/IAA-ARF-dimerisation (InterPro:IPR011525),
AUX/IAA protein (InterPro:IPR003311); BEST Arabidopsis
thaliana protein match is: indole-3-acetic acid inducible
19 (TAIR:AT3G15540.1); Has 1737 Blast hits to 1736
proteins in 78 species: Archae - 0; Bacteria - 0; Metazoa
- 0; Fungi - 0; Plants - 1736; Viruses - 0; Other
Eukaryotes - 1 (source: NCBI BLink)."
/codon_start=1
/product="indole-3-acetic acid 6"
/protein_id="NP_175692.1"
/db_xref="Araport:AT1G52830"
/db_xref="GeneID:841717"
/db_xref="TAIR:AT1G52830"
/translation="MAKEGLALEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTS
SALDTENENSVVSSVEDESLPVVKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDG
VPYMRKIDLGSSNSYINLVTVLENLFGCLGIGVAKEGKKCEYIIIYEDKDRDWMLVGD
VPWQMFKESCKRLRIVKRSDATGFGLQQD"
ORIGIN
1 atcattccaa caagagaagt gcttgagaga aaaaaaaagt atcaaaactt catatagcca
61 aatttaaaca aaaagaaaaa agagaagaaa taaatggcaa aggaaggtct agcactcgag
121 atcacagagc ttcgattggg tcttccagga gataattata gcgaaatatc agtatgcgga
181 tcgagtaaga agaagaagag ggtgctctcg gatatgatga cctcatcagc gttagatact
241 gagaatgaaa acagcgtcgt ttcatcagtt gaagatgaat cactgccggt tgtgaagagt
301 caagcggtgg gatggccacc tgtgtgttct tacaggagaa agaagaacaa tgaggaagca
361 tcgaaagcta taggctacgt gaaagtgagc atggatggtg tgccatacat gaggaagatt
421 gaccttggtt cgagcaacag ttatattaat ctagtcacgg ttcttgagaa tctcttcggc
481 tgtcttggca taggagtggc gaaggagggt aagaagtgtg aatacattat tatatacgaa
541 gacaaggata gagactggat gctcgtcgga gatgtacctt ggcagatgtt taaagaatca
601 tgcaagaggc tgaggatcgt gaagagatca gatgcaactg gttttggtct ccagcaagat
661 taatcatact agctagtgtt gatcatcttt aattaaccat aaagtttgaa aaccgttgag
721 taattttttt tcattataat catttttcaa attgtaaaat ttatatgata atgatgatat
781 atacgttttc ttcaaatgta tttccttact ggtcgtatca tactttaatg ttttatggct
841 cattaaaggt gtttctt
//