U.S. flag

An official website of the United States government

Arabidopsis thaliana peroxisomal 3-ketoacyl-CoA thiolase 4 (PKT4), mRNA

NCBI Reference Sequence: NM_100351.5

FASTA Graphics 

LOCUS       NM_100351               1672 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana peroxisomal 3-ketoacyl-CoA thiolase 4 (PKT4),
            mRNA.
ACCESSION   NM_100351
VERSION     NM_100351.5
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1672)
  AUTHORS   Theologis,A., Ecker,J.R., Palm,C.J., Federspiel,N.A., Kaul,S.,
            White,O., Alonso,J., Altafi,H., Araujo,R., Bowman,C.L.,
            Brooks,S.Y., Buehler,E., Chan,A., Chao,Q., Chen,H., Cheuk,R.F.,
            Chin,C.W., Chung,M.K., Conn,L., Conway,A.B., Conway,A.R.,
            Creasy,T.H., Dewar,K., Dunn,P., Etgu,P., Feldblyum,T.V., Feng,J.,
            Fong,B., Fujii,C.Y., Gill,J.E., Goldsmith,A.D., Haas,B.,
            Hansen,N.F., Hughes,B., Huizar,L., Hunter,J.L., Jenkins,J.,
            Johnson-Hopson,C., Khan,S., Khaykin,E., Kim,C.J., Koo,H.L.,
            Kremenetskaia,I., Kurtz,D.B., Kwan,A., Lam,B., Langin-Hooper,S.,
            Lee,A., Lee,J.M., Lenz,C.A., Li,J.H., Li,Y., Lin,X., Liu,S.X.,
            Liu,Z.A., Luros,J.S., Maiti,R., Marziali,A., Militscher,J.,
            Miranda,M., Nguyen,M., Nierman,W.C., Osborne,B.I., Pai,G.,
            Peterson,J., Pham,P.K., Rizzo,M., Rooney,T., Rowley,D., Sakano,H.,
            Salzberg,S.L., Schwartz,J.R., Shinn,P., Southwick,A.M., Sun,H.,
            Tallon,L.J., Tambunga,G., Toriumi,M.J., Town,C.D., Utterback,T.,
            Van Aken,S., Vaysberg,M., Vysotskaia,V.S., Walker,M., Wu,D., Yu,G.,
            Fraser,C.M., Venter,J.C. and Davis,R.W.
  TITLE     Sequence and analysis of chromosome 1 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 816-820 (2000)
   PUBMED   11130712
REFERENCE   2  (bases 1 to 1672)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1672)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-2017) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1672)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   5  (bases 1 to 1672)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003070).
            
            On Sep 12, 2016 this sequence version replaced NM_100351.4.
FEATURES             Location/Qualifiers
     source          1..1672
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="1"
                     /ecotype="Columbia"
     gene            1..1672
                     /gene="PKT4"
                     /locus_tag="AT1G04710"
                     /gene_synonym="3-KETO-ACYL-COA THIOLASE 1; KAT1;
                     peroxisomal 3-ketoacyl-CoA thiolase 4; peroxisomal
                     3-ketoacyl-CoA thiolase 4; T1G11.4; T1G11_4"
                     /note="EC2.3.1.16 thiolase. Its transcript levels change
                     after inducing MUTE expression in a mute background."
                     /db_xref="Araport:AT1G04710"
                     /db_xref="GeneID:839434"
                     /db_xref="TAIR:AT1G04710"
     CDS             57..1388
                     /gene="PKT4"
                     /locus_tag="AT1G04710"
                     /gene_synonym="3-KETO-ACYL-COA THIOLASE 1; KAT1;
                     peroxisomal 3-ketoacyl-CoA thiolase 4; peroxisomal
                     3-ketoacyl-CoA thiolase 4; T1G11.4; T1G11_4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV831053.1,INSD:EL230536.1,INSD:DR278984.1,
                     INSD:EG454898.1,INSD:EH809807.1,INSD:BP854056.2,
                     INSD:BP859071.1,INSD:EG454899.1,INSD:EL985756.1,
                     INSD:DR278985.1,INSD:BE524191.1,INSD:AV440397.1,
                     INSD:BE527213.1,INSD:ES194267.1,INSD:EL096596.1,
                     INSD:BE529379.1,INSD:EL179902.1,INSD:ES002136.1,
                     INSD:AV814589.1,INSD:DR380590.1,INSD:EL999694.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY099741.1,INSD:AY085052.1,INSD:BT003415.1"
                     /note="peroxisomal 3-ketoacyl-CoA thiolase 4 (PKT4);
                     FUNCTIONS IN: transferase activity, transferring acyl
                     groups other than amino-acyl groups, catalytic activity,
                     acetyl-CoA C-acyltransferase activity; INVOLVED IN:
                     catechol catabolic process, ortho-cleavage,
                     protocatechuate catabolic process, ortho-cleavage,
                     metabolic process, fatty acid oxidation; LOCATED IN:
                     peroxisome, vacuole; EXPRESSED IN: 23 plant structures;
                     EXPRESSED DURING: 14 growth stages; CONTAINS InterPro
                     DOMAIN/s: Thiolase (InterPro:IPR002155), Thiolase, active
                     site (InterPro:IPR020610), Thiolase, N-terminal
                     (InterPro:IPR020616), Thiolase, conserved site
                     (InterPro:IPR020613), Thiolase, C-terminal
                     (InterPro:IPR020617), Thiolase-like, subgroup
                     (InterPro:IPR016038), Thiolase-like (InterPro:IPR016039),
                     Thiolase, acyl-enzyme intermediate active site
                     (InterPro:IPR020615); BEST Arabidopsis thaliana protein
                     match is: peroxisomal 3-ketoacyl-CoA thiolase 3
                     (TAIR:AT2G33150.1); Has 22406 Blast hits to 22392 proteins
                     in 2262 species: Archae - 405; Bacteria - 14105; Metazoa -
                     1004; Fungi - 662; Plants - 281; Viruses - 0; Other
                     Eukaryotes - 5949 (source: NCBI BLink)."
                     /codon_start=1
                     /product="peroxisomal 3-ketoacyl-CoA thiolase 4"
                     /protein_id="NP_171965.1"
                     /db_xref="Araport:AT1G04710"
                     /db_xref="GeneID:839434"
                     /db_xref="TAIR:AT1G04710"
                     /translation="MEKATERQRILLRHLQPSSSSDASLSASACLSKDSAAYQYGDDV
                     VIVAAQRTALCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGS
                     QRASECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM
                     TTNPRGWKGSVNPNVKKFEQAHNCLLPMGITSENVAHRFNVSREEQDQAAVDSHRKAA
                     SATASGKFKDEITPVKTKIVDPKTGDEKPITVSVDDGIRPNTTLSGLAKLKPVFKEDG
                     TTTAGNSSQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIP
                     AAVKAAGLELNDVDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAIAIGHPLGATGA
                     RCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRKV"
ORIGIN      
        1 gctttacaac gaacggttta gcccagtttg ggcttcaaaa taatcaaacg aaaacaatgg
       61 aaaaagcaac ggagagacaa aggatactgc ttcgtcatct tcaaccttcg tcatcttccg
      121 acgcctctct ctctgcctca gcttgcttgt ccaaagacag tgctgcatat caatatggag
      181 atgatgttgt cattgtcgcg gcacaaagga ctgcactttg caaggcaaaa cgtggcagct
      241 tcaaggatac atttccagac gagttgcttg cctctgtatt gagagcattg atagagaaaa
      301 ctaatgtaaa cccaagtgaa gttggtgaca ttgtagtggg tactgttttg ggaccaggat
      361 ctcagagagc cagtgaatgc aggatggctg cgttctatgc tggtttcccc gaaactgttc
      421 ccatcagaac cgtgaacaga cagtgttcat ctgggcttca ggctgttgct gatgttgccg
      481 ctgccataaa agctggtttt tatgacattg gtattggagc tgggctggag tccatgacaa
      541 ctaatccaag gggatggaaa ggatcagtca acccaaatgt gaagaagttt gaacaagctc
      601 acaattgcct tcttccaatg ggtattactt cagaaaatgt agcacaccgg tttaatgttt
      661 caagggagga gcaggatcaa gctgctgttg attctcacag aaaggctgct tctgctactg
      721 cttccggaaa gtttaaggat gagataaccc ctgtaaaaac caagattgtt gacccaaaga
      781 caggtgatga gaaacccata acagtttctg tggatgatgg gattcgacct aacacaaccc
      841 tttccggact tgcaaagctg aagccagtgt ttaaggaaga cggaaccaca actgctggga
      901 attctagcca attaagtgac ggtgctggag ctgttctcct tatgaggaga aatgtcgcaa
      961 tgcagaaagg ccttcccatt cttggtgtat tcaggacatt ttctgcagtt ggtgtggacc
     1021 cagccatcat gggggttggg ccagccgttg ccattcctgc tgcagtcaag gcagctggtt
     1081 tagaactcaa tgacgtcgac ttgtttgaga ttaacgaggc atttgcatct cagtttgttt
     1141 attgtcggaa caagctcggg ctagacgcgg aaaagatcaa tgtcaatgga ggagccatag
     1201 ccattggaca tcccttgggc gctacaggag ccagatgcgt tgcgacgctg ctgcatgaga
     1261 tgaaacgacg tggtaaagac tgtcgttttg gcgtagtgtc aatgtgtata ggttcgggaa
     1321 tgggagcagc cgctgtgttt gagagaggag gcggtgtgga tgagctctgt gatgtccgga
     1381 aagtctaatg acaataaggc cttttgacca aggaccctag ctaaggacca aattagaaca
     1441 cagtactaca aataaacatt atcacaaata aatgcgttct agatgaataa atcataacga
     1501 tagtacaata catgagggaa aacttcttgt tattttttaa ctctcttttg ttatatggtt
     1561 ggaatatata cagatactct ttgagaacat atcataatct atttggtttg tcatatgtat
     1621 gtacacaatt gtagaactat attattgaat cacgttgcat agtaatgatt aa
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for peroxisomal 3-ketoacyl-CoA thiolase 4 (NP_171965.1).

More about the PKT4 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.