Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_063011.6
FASTA Graphics
LOCUS NM_063011 1050 bp mRNA linear INV 04-DEC-2024 DEFINITION Caenorhabditis elegans RRM domain-containing protein (hrpl-1), partial mRNA. ACCESSION NM_063011 VERSION NM_063011.6 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 1050) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 1050) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1050) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (17-OCT-2024) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 1050) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003280). On Apr 15, 2020 this sequence version replaced NM_063011.5. COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..1050 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="II" gene <1..1050 /gene="hrpl-1" /locus_tag="CELE_C44B7.2" /db_xref="GeneID:3565706" /db_xref="WormBase:WBGene00016624" CDS 1..1020 /gene="hrpl-1" /locus_tag="CELE_C44B7.2" /standard_name="C44B7.2b" /note="Confirmed by transcript evidence" /codon_start=1 /product="RRM domain-containing protein" /protein_id="NP_495412.1" /db_xref="GeneID:3565706" /db_xref="WormBase:WBGene00016624" /translation="MQGRGGYHHGFDGPKRYRRDDNADPTNPNPSIVVHVRNLHQKVT EADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKACVNFATSNQINVGGQGALFN YSTSQCIERMGFESATPNKVLVVTVLNAQYPIDADVIYQISNAQGKVLRVAVMHKPTV VQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAKPDRVRVQRQDKDQRDFTLPD NRRPYEDDRNHYDRHDYQAPSSYGYSSRGGGHSDYYGGDRGGPPHPPPSRYRDDYEDR GYAQPAGGGPGCVMMIYGLEHGKINCDMLFNILCQYGNVLRVSSSRVYYLHVYILDQL HAHKN" ORIGIN 1 atgcaaggaa gaggcggata tcatcacgga ttcgacggac cgaagcgcta tcgtcgagat 61 gataatgcgg acccaacaaa tccaaatcca tcgatagtgg tccacgttcg aaatcttcat 121 caaaaagtaa ccgaggccga tcttctcgaa gctctcagta attttggacc agttgcatat 181 gcaacatgca taccgcattc tcgaatggct cttgttgagt ttgaggatat tgaaggagcg 241 aaagcatgcg ttaatttcgc cacatcaaac caaatcaacg tcggtgggca gggtgctcta 301 ttcaattact caacatctca atgtatcgag cgaatgggat tcgagtcagc aactccaaac 361 aaagtcttgg ttgtaacagt tctaaatgct caatatccca tcgatgccga tgtcatctac 421 cagatttcta atgcacaagg aaaggtgctt cgtgttgctg taatgcacaa gccaactgta 481 gttcaagcct tagttgaatt tgaaagcatg gaagttgcga aagcagcgaa acacgcaatg 541 aatggagctg atatctattc tggttgttgt actcttaaag ttgaatttgc caagccggat 601 cgagttcgtg ttcaacgtca ggacaaagat caacgagact tcactcttcc agataataga 661 cgtccatatg aagacgatcg gaatcattac gatcgtcatg actatcaagc tccatcttca 721 tatggatatt cttcacgcgg aggaggtcat tcagactatt acggtggtga tcgtggagga 781 ccaccacatc caccaccgtc tcgttatcgt gatgactatg aagacagagg atatgctcag 841 ccggcgggtg gaggtccagg atgtgtgatg atgatctatg gtctcgaaca cggaaagatc 901 aattgtgaca tgctattcaa tattctttgt caatatggaa acgtcctccg ggtaagttct 961 tcaagagtct attatttaca cgtttatatt ttagatcagc ttcatgcgca caaaaactga 1021 aactggaata attgaattgg gaactccaga //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on