Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_058923.8
FASTA Graphics
LOCUS NM_058923 1480 bp mRNA linear INV 04-DEC-2024 DEFINITION Caenorhabditis elegans C-CAP/cofactor C-like domain-containing protein (cas-2), partial mRNA. ACCESSION NM_058923 VERSION NM_058923.8 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 1480) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 1480) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1480) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (17-OCT-2024) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 1480) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003279). On Feb 2, 2021 this sequence version replaced NM_058923.7. COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..1480 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="I" gene <1..1480 /gene="cas-2" /locus_tag="CELE_C18E3.6" /db_xref="GeneID:266829" /db_xref="WormBase:WBGene00015975" CDS 1..1374 /gene="cas-2" /locus_tag="CELE_C18E3.6" /standard_name="C18E3.6a" /note="Confirmed by transcript evidence" /codon_start=1 /product="C-CAP/cofactor C-like domain-containing protein" /protein_id="NP_491324.1" /db_xref="GeneID:266829" /db_xref="WormBase:WBGene00015975" /translation="MDPSVVSRLENVANRTENILLKYDSNKKETPVDATPQIINLYDD AICENLVSFYDLSAKIGGDLNRLGCMTRSLFFTHRYFLWIACGRKKADNDEFATLVND LSKEIVAFSDFKEKNRKSEFYNHICGLEAAVGGFGWVAEPKTPAPFIKDAIDTSVFYL NRILMEHKGKNDFHSEWAKSIKELMLSLHEYVRQHHTTGLVWNSDPGATPMCNRKSGG APTPPPPPPPPISLIAPSKPSGVGALLESLNTGLSATSRLKKVTPEMQTHKNPVLREV NGQMNRKTEERKVSENKKPEKIHESSIFWDGKIWKVDHQVGNKNAVVEVTDKKESIYI YKCNDSIIKIKGKANAITLDGCRKTSVVFDGLVAQCEIINCQSIQIQTLGELPTVSIQ KTDGCHIYLSRDALNAQIVASKSSEMNISAMLEDGDDEYTEMALPEQFMTKIVGKKLV TVASEIV" ORIGIN 1 atggatcctt ctgttgtgtc tcgattggag aatgttgcga atcgaacgga gaatatattg 61 ctgaaatatg actcgaacaa aaaagaaact ccggtcgacg cgacgcctca aatcattaat 121 ctttatgacg atgcgatctg tgagaatctc gtctcgtttt atgatttatc tgcaaaaatt 181 ggaggagatt tgaatcgcct tggatgcatg actaggagtc tatttttcac gcatcgatat 241 tttttgtgga ttgcgtgtgg gcgcaaaaag gcggacaacg acgagttcgc gactcttgtg 301 aacgatttgt cgaaggaaat tgttgcattt tccgatttca aggagaaaaa tcgaaaatcc 361 gaattctata atcatatctg cggacttgaa gctgcggttg gaggtttcgg ttgggttgct 421 gaaccaaaaa ctcctgctcc attcatcaaa gatgctatcg atacatcagt cttctaccta 481 aatcgtattc ttatggagca caaaggaaaa aatgatttcc attcggaatg ggctaaatct 541 atcaaagaac tcatgctgag tcttcatgaa tatgtgcgac aacatcacac gactggtctt 601 gtctggaatt cggatcccgg tgcgactccg atgtgtaaca ggaaaagtgg aggagctcca 661 acgccgccgc caccaccacc tccaccaatt tcattgattg cgccttccaa gccttctggt 721 gtcggtgctc tactggaatc tctcaatacg ggattatcgg ctactagtcg tttgaagaaa 781 gtcacccctg aaatgcaaac tcacaaaaat ccggtacttc gtgaggtaaa tggacagatg 841 aatcgaaaaa ctgaagaaag aaaggtgagc gagaacaaga aaccggagaa aattcacgaa 901 tcgagcattt tctgggatgg aaagatttgg aaagttgatc atcaagttgg taataagaat 961 gccgtcgttg aagttacgga taagaaggaa tcgatttata tttacaagtg taacgattct 1021 attatcaaga tcaaaggaaa ggccaacgca attacattgg acggatgccg taaaacttca 1081 gtcgtatttg atggtcttgt tgctcaatgt gaaatcatca attgccaatc aattcaaatt 1141 caaactctcg gagaacttcc aactgtttcg attcaaaaaa ccgatggatg tcatatctat 1201 ctgtcacgtg atgctttgaa tgctcaaatt gttgcatcca aatccagtga gatgaacatc 1261 tccgcgatgt tggaagatgg agacgatgag tacacggaaa tggcattgcc agagcagttt 1321 atgacgaaga ttgttggaaa gaagcttgtc actgtcgcat ctgaaattgt ataattagct 1381 ttaaagtttt aatgcattct ccgaatatct ccctactatc cctcatctct tcctcctgct 1441 ggatctcgtt ctcctatcaa aaaataaatt attttctgtg //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on