U.S. flag

An official website of the United States government

Rattus norvegicus GABA type A receptor associated protein like 2 (Gabarapl2), mRNA

NCBI Reference Sequence: NM_022706.2

FASTA Graphics 

LOCUS       NM_022706               1619 bp    mRNA    linear   ROD 03-APR-2024
DEFINITION  Rattus norvegicus GABA type A receptor associated protein like 2
            (Gabarapl2), mRNA.
ACCESSION   NM_022706
VERSION     NM_022706.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1619)
  AUTHORS   Mandell,M.A., Jain,A., Arko-Mensah,J., Chauhan,S., Kimura,T.,
            Dinkins,C., Silvestri,G., Munch,J., Kirchhoff,F., Simonsen,A.,
            Wei,Y., Levine,B., Johansen,T. and Deretic,V.
  TITLE     TRIM proteins regulate autophagy and can target autophagic
            substrates by direct recognition
  JOURNAL   Dev Cell 30 (4), 394-409 (2014)
   PUBMED   25127057
REFERENCE   2  (bases 1 to 1619)
  AUTHORS   Zhong,W., Zhou,Y., Li,S., Zhou,T., Ma,H., Wei,K., Li,H.,
            Olkkonen,V.M. and Yan,D.
  TITLE     OSBP-related protein 7 interacts with GATE-16 and negatively
            regulates GS28 protein stability
  JOURNAL   Exp Cell Res 317 (16), 2353-2363 (2011)
   PUBMED   21669198
REFERENCE   3  (bases 1 to 1619)
  AUTHORS   Behrends,C., Sowa,M.E., Gygi,S.P. and Harper,J.W.
  TITLE     Network organization of the human autophagy system
  JOURNAL   Nature 466 (7302), 68-76 (2010)
   PUBMED   20562859
REFERENCE   4  (bases 1 to 1619)
  AUTHORS   Nowak,J., Archange,C., Tardivel-Lacombe,J., Pontarotti,P.,
            Pebusque,M.J., Vaccaro,M.I., Velasco,G., Dagorn,J.C. and
            Iovanna,J.L.
  TITLE     The TP53INP2 protein is required for autophagy in mammalian cells
  JOURNAL   Mol Biol Cell 20 (3), 870-881 (2009)
   PUBMED   19056683
REFERENCE   5  (bases 1 to 1619)
  AUTHORS   Tanida,I., Ueno,T. and Kominami,E.
  TITLE     LC3 conjugation system in mammalian autophagy
  JOURNAL   Int J Biochem Cell Biol 36 (12), 2503-2518 (2004)
   PUBMED   15325588
  REMARK    Review article
REFERENCE   6  (bases 1 to 1619)
  AUTHORS   Kabeya,Y., Mizushima,N., Yamamoto,A., Oshitani-Okamoto,S.,
            Ohsumi,Y. and Yoshimori,T.
  TITLE     LC3, GABARAP and GATE16 localize to autophagosomal membrane
            depending on form-II formation
  JOURNAL   J Cell Sci 117 (Pt 13), 2805-2812 (2004)
   PUBMED   15169837
REFERENCE   7  (bases 1 to 1619)
  AUTHORS   Xin,Y., Yu,L., Chen,Z., Zheng,L., Fu,Q., Jiang,J., Zhang,P.,
            Gong,R. and Zhao,S.
  TITLE     Cloning, expression patterns, and chromosome localization of three
            human and two mouse homologues of GABA(A) receptor-associated
            protein
  JOURNAL   Genomics 74 (3), 408-413 (2001)
   PUBMED   11414770
REFERENCE   8  (bases 1 to 1619)
  AUTHORS   Sagiv,Y., Legesse-Miller,A., Porat,A. and Elazar,Z.
  TITLE     GATE-16, a membrane transport modulator, interacts with NSF and the
            Golgi v-SNARE GOS-28
  JOURNAL   EMBO J 19 (7), 1494-1504 (2000)
   PUBMED   10747018
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC088139.1.
            
            On Jan 2, 2005 this sequence version replaced NM_022706.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC088139.1, FQ216852.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1619
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="19"
                     /map="19q12"
     gene            1..1619
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /note="GABA type A receptor associated protein like 2"
                     /db_xref="GeneID:64670"
                     /db_xref="RGD:620510"
     exon            1..102
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /inference="alignment:Splign:2.1.0"
     CDS             69..422
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /note="GEF-2; GATE-16; golgi-associated ATPase enhancer of
                     16 kDa; ganglioside expression factor 2; GABA(A)
                     receptor-associated protein like 2"
                     /codon_start=1
                     /product="gamma-aminobutyric acid receptor-associated
                     protein-like 2"
                     /protein_id="NP_073197.1"
                     /db_xref="GeneID:64670"
                     /db_xref="RGD:620510"
                     /translation="MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDI
                     DKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDED
                     GFLYVAYSGENTFGF"
     mat_peptide     69..416
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /product="Gamma-aminobutyric acid receptor-associated
                     protein-like 2. /id=PRO_0000212375"
                     /note="propagated from UniProtKB/Swiss-Prot (P60522.1)"
     misc_feature    138..140
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P60520; propagated from
                     UniProtKB/Swiss-Prot (P60522.1); acetylation site"
     misc_feature    183..185
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P60520; propagated from
                     UniProtKB/Swiss-Prot (P60522.1); phosphorylation site"
     misc_feature    327..329
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P60520; propagated from
                     UniProtKB/Swiss-Prot (P60522.1); phosphorylation site"
     misc_feature    330..332
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P60520; propagated from
                     UniProtKB/Swiss-Prot (P60522.1); phosphorylation site"
     misc_feature    414..419
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /note="Cleavage, by ATG4.
                     /evidence=ECO:0000250|UniProtKB:P60520; propagated from
                     UniProtKB/Swiss-Prot (P60522.1); cleavage site"
     exon            103..158
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /inference="alignment:Splign:2.1.0"
     exon            159..331
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /inference="alignment:Splign:2.1.0"
     exon            332..1593
                     /gene="Gabarapl2"
                     /gene_synonym="Gef2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
        1 cgttgttgtt gtggtcgctt cgccgaagtc tgcggctcaa agagccggct ccgtcgcttc
       61 ccgccgccat gaagtggatg tttaaggagg accactcgct ggaacacaga tgcgtggaat
      121 ccgcgaagat cagagcgaaa taccccgacc gggttccggt gatcgttgag aaagtctctg
      181 gctctcagat tgttgacatt gacaagagga agtacttggt cccatctgac atcactgtgg
      241 ctcagttcat gtggatcatc aggaaaagga tccagcttcc ttctgagaag gccatcttct
      301 tgtttgtgga caagacagtc ccacagtcca gcctaactat gggacagctt tacgagaagg
      361 aaaaagatga agatggattc ttgtatgtgg cctacagcgg agagaacact tttggcttct
      421 gagcccttgc tgggctaggt gcacccttcc tgcttgtgta tcctgtaaat aactggctgt
      481 tctcagttac tccgccggag cctccacaca gacctactag tgcatttgta actggattta
      541 tttcttaata tattggaagg ttttgttttc cttagattag taaattatca tacagagttt
      601 tattttcagt tttcttttgt gcactgtcct catggctata tgctccaagg aacctgtcct
      661 ccggaatcac atttaatgaa gatacttccg aaatgaaggg cggtaggtgt ggtattaaag
      721 tgacaaggag ggatgacgca ttgttctgga ttatgttcgg agtgttagac ggctaagtat
      781 taaaagcccc caaattaaat ccttagcaat cagaacactt gcttcactag attttgccaa
      841 ctgcaaatca tgttggactg agctaatctg ttctttctga gactataagg taaatgatta
      901 acaataaagc ctccatgtaa aggcattaca gtgtgaccat ggtcctcatt caccttcacg
      961 agtcagaaat ggctcctgca acagcttagc ctaggatggg aagttgtggc tggtatcata
     1021 aaaagggttg gtttttttca gtggttaatg tagtcatagg ttcagatttg ggactgtatc
     1081 aaaaggttta tactgcaaag tctcgcttct accacttttt ctgatctctg ctgcttatgg
     1141 gaaattgtat gggcttattt tcagtatttt agtagcaaaa gtttaagtac gaatatatat
     1201 atattttaga agttattttg cctgcatgtg tgtctgtggg cgtgactgat ctgcatttgt
     1261 gagctgccgt gtgggtactg ggaattgaac ccaggtcccc tggaaaagca gccagtgctc
     1321 ttacatgcag aactctctct ctagcaccat atatgcatat ttgtttacat atgtaaataa
     1381 aatgtgtata tgttattaaa acatatagag ggctgaagag atggctcagc agctaagggc
     1441 aatgaggtcc tgggtttaat tcccagcagc cacatggtgg ctcttcatga tgtcatctga
     1501 tgcccttacc tgcctgcagg tctatttgca gatagagcac tcatatacat aaatctttct
     1561 ttaaaaaaat aaaacgtatg tttatacact ggaaaaaaaa aaaaaaaaaa aaaaaaaaa
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for gamma-aminobutyric acid receptor-associated protein-like 2 (NP_073197.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.