LOCUS NM_022706 1619 bp mRNA linear ROD 03-APR-2024
DEFINITION Rattus norvegicus GABA type A receptor associated protein like 2
(Gabarapl2), mRNA.
ACCESSION NM_022706
VERSION NM_022706.2
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 1619)
AUTHORS Mandell,M.A., Jain,A., Arko-Mensah,J., Chauhan,S., Kimura,T.,
Dinkins,C., Silvestri,G., Munch,J., Kirchhoff,F., Simonsen,A.,
Wei,Y., Levine,B., Johansen,T. and Deretic,V.
TITLE TRIM proteins regulate autophagy and can target autophagic
substrates by direct recognition
JOURNAL Dev Cell 30 (4), 394-409 (2014)
PUBMED 25127057
REFERENCE 2 (bases 1 to 1619)
AUTHORS Zhong,W., Zhou,Y., Li,S., Zhou,T., Ma,H., Wei,K., Li,H.,
Olkkonen,V.M. and Yan,D.
TITLE OSBP-related protein 7 interacts with GATE-16 and negatively
regulates GS28 protein stability
JOURNAL Exp Cell Res 317 (16), 2353-2363 (2011)
PUBMED 21669198
REFERENCE 3 (bases 1 to 1619)
AUTHORS Behrends,C., Sowa,M.E., Gygi,S.P. and Harper,J.W.
TITLE Network organization of the human autophagy system
JOURNAL Nature 466 (7302), 68-76 (2010)
PUBMED 20562859
REFERENCE 4 (bases 1 to 1619)
AUTHORS Nowak,J., Archange,C., Tardivel-Lacombe,J., Pontarotti,P.,
Pebusque,M.J., Vaccaro,M.I., Velasco,G., Dagorn,J.C. and
Iovanna,J.L.
TITLE The TP53INP2 protein is required for autophagy in mammalian cells
JOURNAL Mol Biol Cell 20 (3), 870-881 (2009)
PUBMED 19056683
REFERENCE 5 (bases 1 to 1619)
AUTHORS Tanida,I., Ueno,T. and Kominami,E.
TITLE LC3 conjugation system in mammalian autophagy
JOURNAL Int J Biochem Cell Biol 36 (12), 2503-2518 (2004)
PUBMED 15325588
REMARK Review article
REFERENCE 6 (bases 1 to 1619)
AUTHORS Kabeya,Y., Mizushima,N., Yamamoto,A., Oshitani-Okamoto,S.,
Ohsumi,Y. and Yoshimori,T.
TITLE LC3, GABARAP and GATE16 localize to autophagosomal membrane
depending on form-II formation
JOURNAL J Cell Sci 117 (Pt 13), 2805-2812 (2004)
PUBMED 15169837
REFERENCE 7 (bases 1 to 1619)
AUTHORS Xin,Y., Yu,L., Chen,Z., Zheng,L., Fu,Q., Jiang,J., Zhang,P.,
Gong,R. and Zhao,S.
TITLE Cloning, expression patterns, and chromosome localization of three
human and two mouse homologues of GABA(A) receptor-associated
protein
JOURNAL Genomics 74 (3), 408-413 (2001)
PUBMED 11414770
REFERENCE 8 (bases 1 to 1619)
AUTHORS Sagiv,Y., Legesse-Miller,A., Porat,A. and Elazar,Z.
TITLE GATE-16, a membrane transport modulator, interacts with NSF and the
Golgi v-SNARE GOS-28
JOURNAL EMBO J 19 (7), 1494-1504 (2000)
PUBMED 10747018
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from BC088139.1.
On Jan 2, 2005 this sequence version replaced NM_022706.1.
##Evidence-Data-START##
Transcript exon combination :: BC088139.1, FQ216852.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMD00132261, SAMD00132262
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..1619
/organism="Rattus norvegicus"
/mol_type="mRNA"
/db_xref="taxon:10116"
/chromosome="19"
/map="19q12"
gene 1..1619
/gene="Gabarapl2"
/gene_synonym="Gef2"
/note="GABA type A receptor associated protein like 2"
/db_xref="GeneID:64670"
/db_xref="RGD:620510"
exon 1..102
/gene="Gabarapl2"
/gene_synonym="Gef2"
/inference="alignment:Splign:2.1.0"
CDS 69..422
/gene="Gabarapl2"
/gene_synonym="Gef2"
/note="GEF-2; GATE-16; golgi-associated ATPase enhancer of
16 kDa; ganglioside expression factor 2; GABA(A)
receptor-associated protein like 2"
/codon_start=1
/product="gamma-aminobutyric acid receptor-associated
protein-like 2"
/protein_id="NP_073197.1"
/db_xref="GeneID:64670"
/db_xref="RGD:620510"
/translation="MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDI
DKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDED
GFLYVAYSGENTFGF"
mat_peptide 69..416
/gene="Gabarapl2"
/gene_synonym="Gef2"
/product="Gamma-aminobutyric acid receptor-associated
protein-like 2. /id=PRO_0000212375"
/note="propagated from UniProtKB/Swiss-Prot (P60522.1)"
misc_feature 138..140
/gene="Gabarapl2"
/gene_synonym="Gef2"
/note="N6-acetyllysine.
/evidence=ECO:0000250|UniProtKB:P60520; propagated from
UniProtKB/Swiss-Prot (P60522.1); acetylation site"
misc_feature 183..185
/gene="Gabarapl2"
/gene_synonym="Gef2"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P60520; propagated from
UniProtKB/Swiss-Prot (P60522.1); phosphorylation site"
misc_feature 327..329
/gene="Gabarapl2"
/gene_synonym="Gef2"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P60520; propagated from
UniProtKB/Swiss-Prot (P60522.1); phosphorylation site"
misc_feature 330..332
/gene="Gabarapl2"
/gene_synonym="Gef2"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P60520; propagated from
UniProtKB/Swiss-Prot (P60522.1); phosphorylation site"
misc_feature 414..419
/gene="Gabarapl2"
/gene_synonym="Gef2"
/note="Cleavage, by ATG4.
/evidence=ECO:0000250|UniProtKB:P60520; propagated from
UniProtKB/Swiss-Prot (P60522.1); cleavage site"
exon 103..158
/gene="Gabarapl2"
/gene_synonym="Gef2"
/inference="alignment:Splign:2.1.0"
exon 159..331
/gene="Gabarapl2"
/gene_synonym="Gef2"
/inference="alignment:Splign:2.1.0"
exon 332..1593
/gene="Gabarapl2"
/gene_synonym="Gef2"
/inference="alignment:Splign:2.1.0"
ORIGIN
1 cgttgttgtt gtggtcgctt cgccgaagtc tgcggctcaa agagccggct ccgtcgcttc
61 ccgccgccat gaagtggatg tttaaggagg accactcgct ggaacacaga tgcgtggaat
121 ccgcgaagat cagagcgaaa taccccgacc gggttccggt gatcgttgag aaagtctctg
181 gctctcagat tgttgacatt gacaagagga agtacttggt cccatctgac atcactgtgg
241 ctcagttcat gtggatcatc aggaaaagga tccagcttcc ttctgagaag gccatcttct
301 tgtttgtgga caagacagtc ccacagtcca gcctaactat gggacagctt tacgagaagg
361 aaaaagatga agatggattc ttgtatgtgg cctacagcgg agagaacact tttggcttct
421 gagcccttgc tgggctaggt gcacccttcc tgcttgtgta tcctgtaaat aactggctgt
481 tctcagttac tccgccggag cctccacaca gacctactag tgcatttgta actggattta
541 tttcttaata tattggaagg ttttgttttc cttagattag taaattatca tacagagttt
601 tattttcagt tttcttttgt gcactgtcct catggctata tgctccaagg aacctgtcct
661 ccggaatcac atttaatgaa gatacttccg aaatgaaggg cggtaggtgt ggtattaaag
721 tgacaaggag ggatgacgca ttgttctgga ttatgttcgg agtgttagac ggctaagtat
781 taaaagcccc caaattaaat ccttagcaat cagaacactt gcttcactag attttgccaa
841 ctgcaaatca tgttggactg agctaatctg ttctttctga gactataagg taaatgatta
901 acaataaagc ctccatgtaa aggcattaca gtgtgaccat ggtcctcatt caccttcacg
961 agtcagaaat ggctcctgca acagcttagc ctaggatggg aagttgtggc tggtatcata
1021 aaaagggttg gtttttttca gtggttaatg tagtcatagg ttcagatttg ggactgtatc
1081 aaaaggttta tactgcaaag tctcgcttct accacttttt ctgatctctg ctgcttatgg
1141 gaaattgtat gggcttattt tcagtatttt agtagcaaaa gtttaagtac gaatatatat
1201 atattttaga agttattttg cctgcatgtg tgtctgtggg cgtgactgat ctgcatttgt
1261 gagctgccgt gtgggtactg ggaattgaac ccaggtcccc tggaaaagca gccagtgctc
1321 ttacatgcag aactctctct ctagcaccat atatgcatat ttgtttacat atgtaaataa
1381 aatgtgtata tgttattaaa acatatagag ggctgaagag atggctcagc agctaagggc
1441 aatgaggtcc tgggtttaat tcccagcagc cacatggtgg ctcttcatga tgtcatctga
1501 tgcccttacc tgcctgcagg tctatttgca gatagagcac tcatatacat aaatctttct
1561 ttaaaaaaat aaaacgtatg tttatacact ggaaaaaaaa aaaaaaaaaa aaaaaaaaa
//