LOCUS NM_021381 4115 bp mRNA linear ROD 07-AUG-2024
DEFINITION Mus musculus prokineticin receptor 1 (Prokr1), transcript variant
1, mRNA.
ACCESSION NM_021381
VERSION NM_021381.4
KEYWORDS RefSeq; RefSeq Select.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 4115)
AUTHORS Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
Jackson,S.P. and Balmus,G.
CONSRTM Sanger Mouse Genetics Project
TITLE Genetic determinants of micronucleus formation in vivo
JOURNAL Nature 627 (8002), 130-136 (2024)
PUBMED 38355793
REFERENCE 2 (bases 1 to 4115)
AUTHORS Mok,J., Park,J.H., Yeom,S.C. and Park,J.
TITLE PROKR1-CREB-NR4A2 axis for oxidative muscle fiber specification and
improvement of metabolic function
JOURNAL Proc Natl Acad Sci U S A 121 (4), e2308960121 (2024)
PUBMED 38232288
REFERENCE 3 (bases 1 to 4115)
AUTHORS Zhang,C., Mok,J., Seong,Y., Lau,H.C., Kim,D., Yoon,J., Oh,S.W.,
Park,T.S. and Park,J.
TITLE PROKR1 delivery by cell-derived vesicles restores the myogenic
potential of Prokr1-deficient C2C12 myoblasts
JOURNAL Nanomedicine 37, 102448 (2021)
PUBMED 34314870
REMARK GeneRIF: PROKR1 delivery by cell-derived vesicles restores the
myogenic potential of Prokr1-deficient C2C12 myoblasts.
REFERENCE 4 (bases 1 to 4115)
AUTHORS Bedogni,F. and Hevner,R.F.
TITLE Cell-Type-Specific Gene Expression in Developing Mouse Neocortex:
Intermediate Progenitors Implicated in Axon Development
JOURNAL Front Mol Neurosci 14, 686034 (2021)
PUBMED 34321999
REMARK Publication Status: Online-Only
REFERENCE 5 (bases 1 to 4115)
AUTHORS Casella,I. and Ambrosio,C.
TITLE Prokineticin receptors interact unselectively with several G
protein subtypes but bind selectively to beta-arrestin 2
JOURNAL Cell Signal 83, 110000 (2021)
PUBMED 33811988
REMARK GeneRIF: Prokineticin receptors interact unselectively with several
G protein subtypes but bind selectively to beta-arrestin 2.
REFERENCE 6 (bases 1 to 4115)
AUTHORS LeCouter,J., Lin,R., Frantz,G., Zhang,Z., Hillan,K. and Ferrara,N.
TITLE Mouse endocrine gland-derived vascular endothelial growth factor: a
distinct expression pattern from its human ortholog suggests
different roles as a regulator of organ-specific angiogenesis
JOURNAL Endocrinology 144 (6), 2606-2616 (2003)
PUBMED 12746324
REFERENCE 7 (bases 1 to 4115)
AUTHORS LeCouter,J., Lin,R., Tejada,M., Frantz,G., Peale,F., Hillan,K.J.
and Ferrara,N.
TITLE The endocrine-gland-derived VEGF homologue Bv8 promotes
angiogenesis in the testis: Localization of Bv8 receptors to
endothelial cells
JOURNAL Proc Natl Acad Sci U S A 100 (5), 2685-2690 (2003)
PUBMED 12604792
REFERENCE 8 (bases 1 to 4115)
AUTHORS Cheng,M.Y., Bullock,C.M., Li,C., Lee,A.G., Bermak,J.C.,
Belluzzi,J., Weaver,D.R., Leslie,F.M. and Zhou,Q.Y.
TITLE Prokineticin 2 transmits the behavioural circadian rhythm of the
suprachiasmatic nucleus
JOURNAL Nature 417 (6887), 405-410 (2002)
PUBMED 12024206
REFERENCE 9 (bases 1 to 4115)
AUTHORS Nili,E., Cojocaru,G.S., Kalma,Y., Ginsberg,D., Copeland,N.G.,
Gilbert,D.J., Jenkins,N.A., Berger,R., Shaklai,S., Amariglio,N.,
Brok-Simoni,F., Simon,A.J. and Rechavi,G.
TITLE Nuclear membrane protein LAP2beta mediates transcriptional
repression alone and together with its binding partner GCL
(germ-cell-less)
JOURNAL J Cell Sci 114 (Pt 18), 3297-3307 (2001)
PUBMED 11591818
REFERENCE 10 (bases 1 to 4115)
AUTHORS Parker,R., Liu,M., Eyre,H.J., Copeland,N.G., Gilbert,D.J.,
Crawford,J., Sutherland,G.R., Jenkins,N.A. and Herzog,H.
TITLE Y-receptor-like genes GPR72 and GPR73: molecular cloning, genomic
organisation and assignment to human chromosome 11q21.1 and 2p14
and mouse chromosome 9 and 6
JOURNAL Biochim Biophys Acta 1491 (1-3), 369-375 (2000)
PUBMED 10760605
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AC125171.4 and BC059003.1.
On Mar 19, 2018 this sequence version replaced NM_021381.3.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC059003.1, AK134279.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN00849379, SAMN00849381
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on conservation, expression,
longest protein
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-42 AC125171.4 88286-88327 c
43-4115 BC059003.1 1-4073
FEATURES Location/Qualifiers
source 1..4115
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="6"
/map="6 38.28 cM"
gene 1..4115
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/note="prokineticin receptor 1"
/db_xref="GeneID:58182"
/db_xref="MGI:MGI:1929676"
exon 1..143
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/inference="alignment:Splign:2.1.0"
exon 144..773
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/inference="alignment:Splign:2.1.0"
misc_feature 286..288
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/note="upstream in-frame stop codon"
CDS 289..1470
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/note="G-protein coupled receptor 73"
/codon_start=1
/product="prokineticin receptor 1"
/protein_id="NP_067356.2"
/db_xref="CCDS:CCDS20323.1"
/db_xref="GeneID:58182"
/db_xref="MGI:MGI:1929676"
/translation="METTVGALGENTTDTFTDFFSALDGHEAQTGSLPFTFSYGDYDM
PLDEEEDVTNSRTFFAAKIVIGMALVGIMLVCGIGNFIFITALARYKKLRNLTNLLIA
NLAISDFLVAIVCCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNALLAIAI
DRYLAIVHPLRPRMKCQTAAGLIFLVWSVSILIAIPAAYFTTETVLVIVERQEKIFCG
QIWPVDQQFYYRSYFLLVFGLEFVGPVVAMTLCYARVSRELWFKAVPGFQTEQIRRRL
RCRRRTVLGLVCVLSAYVLCWAPFYGFTIVRDFFPSVFVKEKHYLTAFYVVECIAMSN
SMINTLCFVTVRNNTSKYLKRILRLQWRASPSGSKASADLDLRTTGIPATEEVDCIRL
K"
misc_feature 319..321
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q9JKL1.2); glycosylation site"
misc_feature 475..537
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
transmembrane region"
misc_feature 583..645
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
transmembrane region"
misc_feature 727..789
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
transmembrane region"
misc_feature 826..888
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
transmembrane region"
misc_feature 985..1047
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
transmembrane region"
misc_feature 1135..1197
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
transmembrane region"
misc_feature 1255..1317
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
transmembrane region"
exon 774..4098
/gene="Prokr1"
/gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
/inference="alignment:Splign:2.1.0"
ORIGIN
1 ctctgctcag tgtgtccgtc cgccgaagta gtaggaggcc agctgccact cgagcacgga
61 aagaccctca gaagacagag gtgctcctag cccttgctgc agagctccgg aggagcgtct
121 gagatcctcg ctctggttcg caggttgaaa atggaactca gataccgggt cccgcagatg
181 ctggctggaa agatctgact caccgaggga gagccaagtg cttgcagaga ggagtcgtca
241 accttgcgga tgccagtggg actgctccag gggtgtgcac ctgcctagat ggagaccact
301 gtcggggctc tgggtgagaa taccacagac accttcaccg acttcttttc tgcactcgat
361 ggccatgaag cccaaaccgg ctcgttacca ttcactttca gctacggtga ctatgacatg
421 cccctggatg aagaggaaga tgtgaccaat tctcggactt tctttgctgc caagattgtc
481 attggcatgg ctttggtggg tatcatgcta gtgtgtggca tcggcaactt catctttatc
541 actgccctgg cccgctacaa aaagctccgc aacctcacca acctgcttat cgccaacctg
601 gccatttcag acttcctcgt ggccatcgtg tgctgcccct ttgagatgga ctactatgtg
661 gtgcgccagc tctcctggga gcatggtcat gtcctgtgcg cctctgtcaa ctacttgcgt
721 accgtctccc tctacgtctc cactaacgcc ctactggcca ttgccattga caggtatctg
781 gccattgtgc acccgctgag accgcggatg aagtgtcaaa cagccgccgg cctgatcttc
841 ctggtgtggt cagtatccat cctcatcgcc attccagctg cctacttcac cactgagacc
901 gtgctggtca tcgtggagag acaggagaag atcttctgtg gtcagatctg gccggtggat
961 cagcagttct actacaggtc ctatttcctt ttggttttcg gcctcgagtt cgtgggccct
1021 gtagtcgcca tgaccttgtg ctatgccagg gtgtcccggg agctctggtt caaggcggtg
1081 ccaggcttcc agacagagca gatccgccgg aggctgcgct gccgccgcag gactgtgctg
1141 gggctcgtgt gcgtcctctc tgcctatgtg ctgtgctggg ctcccttcta tggcttcact
1201 atcgtgcgtg acttcttccc ctccgtgttt gtgaaggaga agcactacct caccgccttc
1261 tatgtggtgg agtgcatcgc catgagcaac agcatgatca atacgctctg ctttgtgact
1321 gtcaggaata acaccagtaa gtacctcaag aggatcctgc ggcttcagtg gagggcctct
1381 cccagcggga gcaaggccag cgctgacctc gacctcagga ccacgggaat acctgccacc
1441 gaggaggtgg actgcatccg actgaaataa gcaaaatggt accacagcgc ccgggtgcac
1501 acagcagcca tgaacttgtt tttctgcgga aggcagagga aagagacaac tacttagaca
1561 cgctattcaa ggaccactga agtgtggaat ttctgaaatg gagacctgag atactgtcac
1621 tagtggtcag ggttcaccga atatctaatt tttgcaaaga ctagacacca gtgaaagtcc
1681 tttgacaaag taaagtgggg attatagcaa ggaaatatgg attggagtgt ctggaaaagg
1741 ctatttccag agagaaggca gagcaggcta tgtaggactc tcctgtctgt gcttagggtg
1801 gagtacaggg ctctgtgtgg gcctagctca cctctggcag gactcttggg tttttgttta
1861 tgtctagcat tagcaagccc ggagcaagag tatggaagag gttcccagat gtgctgtagt
1921 ccttttctgc ttacctcaga atccccactg aggggaatca gaagcatgag tggacactcc
1981 aggacccacg gctaagttct gcgcatccac ccccaaccta cggtcagatc ttaggcctag
2041 ggctctgcac acagacagtg ggggagggga cttctttgga gcaccgactt gagggaggag
2101 ccacttggac tctgggtgcc atttgcatag ggaatttggg gttctgagtc ataagtttga
2161 gttcaggtga gcatgattcc cccactcatg gtctactcac tgcaggggaa aaggaggtga
2221 agaaggggag ggtcaggtgg gacccctgaa ggcatgcgtg caggttaaag gatgctgttg
2281 cttcatctct cagcatctgt gccctggacc actcgtgctt cttgagactt catgcctctg
2341 agtttatgga gcatagactc atgaaggtaa acgtagcacc ttgctgtccc gttcccacta
2401 gctcccaaac accggtgttt tcatctcagg cagcctattt gatgggattc cctaactggt
2461 aagactggga gaaagatttc ttaaccagtg gtacctgact cttgacctgg tcatggtcct
2521 gggaatgaag acttgctgct ctttccaaat gaaggtgacc ttggagaaat caccacattt
2581 ctgctcttca gcgcacatga agacttgcac atcaggggtg ctgcctggac actcaggaaa
2641 ccgaagatga ccaacagtga gctctaggga ccccacagac ttatgaaagt ctcatcccat
2701 gtgataactc accttcttag cttggcattt agaattctgg cctgagaaaa cctgaggcct
2761 agctttgact aagtcatcta cacagacctg agataagact ttctaaagat aaaggtaata
2821 cttaagaaac cttgttagaa ttgttgggag gtcaatcaaa taatctgtgg aagataagct
2881 gttaactatc tggatagtaa agtattacca ccatttccac caccatcacc accaccacca
2941 tctccagcac catcaccacc accaccacca ccatctccac caccaccagc agcaacagca
3001 acaacagtga actagcaact atggagtgac tggacaaaga caaacttgta catatattct
3061 gtttatgact ctgtcaatct aaccaacttc tctcaatgtt ctccatgtga attattttct
3121 catgcttctc aatactgcat tgtgtcatca tagcacattg gtatcaataa gactgagaat
3181 tttcacggca ggtacataaa ggaagtggta cccagtctcc agtcaggacg tgagcaccag
3241 gctctgcagt ctcaggatca gagcatcctt gttgtcaggt agaagctgtt cccacacatg
3301 cacccagaat cagagcatcc tcactggcca tcattccgca catgtcccag ccagcatgaa
3361 caatgtctcc cagctgcttt tattctgagt gtgcagagca gcagaggggc cgggtccctc
3421 ccctcagatt tctttatagg acaagacatt aattaaatta acctgtgtgt attttctttc
3481 tgaatacagg caactctgtt tttgaccaca acaatttttt tagttgtcta tttcccagaa
3541 aacacatttc aaaggaccat ttatgtattc ttattcagca tgcaacaggt tcaccttact
3601 ttaagtcaga attctctcag agaataaaaa ttcattaatg ttcaaaccta aatcaaacac
3661 agagaaacaa aacccctatt tttttatttt aaactttatt acaaaaaatt gcaaaaaaaa
3721 taaaaataaa aaaggaagaa aagaaaatca cataccaaat taaccagacc aacagactct
3781 tttttttttt taatagtaaa accccatatt gcattaaaaa tggctaagtt agtttggggt
3841 gtaaaaatgc ttagatgaca ggatttattg ggatcatgac actgttcctc ttactaaagc
3901 tagataagag tttgtagttg ctaaatagtt gttgattttt taaactcatg acaaattttc
3961 ttctgatttt tctgctaaaa tgtgtcaaag tttcactttc ctaaactgtc tgtaattctt
4021 ccagatattg gtgtctcctt gtgatttcac agtgaatgct tgttatcaaa tggaatacta
4081 gtagatgtac acatacgaaa aaaaaaaaaa aaaaa
//