U.S. flag

An official website of the United States government

Mus musculus prokineticin receptor 1 (Prokr1), transcript variant 1, mRNA

NCBI Reference Sequence: NM_021381.4

FASTA Graphics 

LOCUS       NM_021381               4115 bp    mRNA    linear   ROD 07-AUG-2024
DEFINITION  Mus musculus prokineticin receptor 1 (Prokr1), transcript variant
            1, mRNA.
ACCESSION   NM_021381
VERSION     NM_021381.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 4115)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   2  (bases 1 to 4115)
  AUTHORS   Mok,J., Park,J.H., Yeom,S.C. and Park,J.
  TITLE     PROKR1-CREB-NR4A2 axis for oxidative muscle fiber specification and
            improvement of metabolic function
  JOURNAL   Proc Natl Acad Sci U S A 121 (4), e2308960121 (2024)
   PUBMED   38232288
REFERENCE   3  (bases 1 to 4115)
  AUTHORS   Zhang,C., Mok,J., Seong,Y., Lau,H.C., Kim,D., Yoon,J., Oh,S.W.,
            Park,T.S. and Park,J.
  TITLE     PROKR1 delivery by cell-derived vesicles restores the myogenic
            potential of Prokr1-deficient C2C12 myoblasts
  JOURNAL   Nanomedicine 37, 102448 (2021)
   PUBMED   34314870
  REMARK    GeneRIF: PROKR1 delivery by cell-derived vesicles restores the
            myogenic potential of Prokr1-deficient C2C12 myoblasts.
REFERENCE   4  (bases 1 to 4115)
  AUTHORS   Bedogni,F. and Hevner,R.F.
  TITLE     Cell-Type-Specific Gene Expression in Developing Mouse Neocortex:
            Intermediate Progenitors Implicated in Axon Development
  JOURNAL   Front Mol Neurosci 14, 686034 (2021)
   PUBMED   34321999
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 4115)
  AUTHORS   Casella,I. and Ambrosio,C.
  TITLE     Prokineticin receptors interact unselectively with several G
            protein subtypes but bind selectively to beta-arrestin 2
  JOURNAL   Cell Signal 83, 110000 (2021)
   PUBMED   33811988
  REMARK    GeneRIF: Prokineticin receptors interact unselectively with several
            G protein subtypes but bind selectively to beta-arrestin 2.
REFERENCE   6  (bases 1 to 4115)
  AUTHORS   LeCouter,J., Lin,R., Frantz,G., Zhang,Z., Hillan,K. and Ferrara,N.
  TITLE     Mouse endocrine gland-derived vascular endothelial growth factor: a
            distinct expression pattern from its human ortholog suggests
            different roles as a regulator of organ-specific angiogenesis
  JOURNAL   Endocrinology 144 (6), 2606-2616 (2003)
   PUBMED   12746324
REFERENCE   7  (bases 1 to 4115)
  AUTHORS   LeCouter,J., Lin,R., Tejada,M., Frantz,G., Peale,F., Hillan,K.J.
            and Ferrara,N.
  TITLE     The endocrine-gland-derived VEGF homologue Bv8 promotes
            angiogenesis in the testis: Localization of Bv8 receptors to
            endothelial cells
  JOURNAL   Proc Natl Acad Sci U S A 100 (5), 2685-2690 (2003)
   PUBMED   12604792
REFERENCE   8  (bases 1 to 4115)
  AUTHORS   Cheng,M.Y., Bullock,C.M., Li,C., Lee,A.G., Bermak,J.C.,
            Belluzzi,J., Weaver,D.R., Leslie,F.M. and Zhou,Q.Y.
  TITLE     Prokineticin 2 transmits the behavioural circadian rhythm of the
            suprachiasmatic nucleus
  JOURNAL   Nature 417 (6887), 405-410 (2002)
   PUBMED   12024206
REFERENCE   9  (bases 1 to 4115)
  AUTHORS   Nili,E., Cojocaru,G.S., Kalma,Y., Ginsberg,D., Copeland,N.G.,
            Gilbert,D.J., Jenkins,N.A., Berger,R., Shaklai,S., Amariglio,N.,
            Brok-Simoni,F., Simon,A.J. and Rechavi,G.
  TITLE     Nuclear membrane protein LAP2beta mediates transcriptional
            repression alone and together with its binding partner GCL
            (germ-cell-less)
  JOURNAL   J Cell Sci 114 (Pt 18), 3297-3307 (2001)
   PUBMED   11591818
REFERENCE   10 (bases 1 to 4115)
  AUTHORS   Parker,R., Liu,M., Eyre,H.J., Copeland,N.G., Gilbert,D.J.,
            Crawford,J., Sutherland,G.R., Jenkins,N.A. and Herzog,H.
  TITLE     Y-receptor-like genes GPR72 and GPR73: molecular cloning, genomic
            organisation and assignment to human chromosome 11q21.1 and 2p14
            and mouse chromosome 9 and 6
  JOURNAL   Biochim Biophys Acta 1491 (1-3), 369-375 (2000)
   PUBMED   10760605
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC125171.4 and BC059003.1.
            
            On Mar 19, 2018 this sequence version replaced NM_021381.3.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC059003.1, AK134279.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849379, SAMN00849381
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-42                AC125171.4         88286-88327         c
            43-4115             BC059003.1         1-4073
FEATURES             Location/Qualifiers
     source          1..4115
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="6"
                     /map="6 38.28 cM"
     gene            1..4115
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /note="prokineticin receptor 1"
                     /db_xref="GeneID:58182"
                     /db_xref="MGI:MGI:1929676"
     exon            1..143
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /inference="alignment:Splign:2.1.0"
     exon            144..773
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    286..288
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /note="upstream in-frame stop codon"
     CDS             289..1470
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /note="G-protein coupled receptor 73"
                     /codon_start=1
                     /product="prokineticin receptor 1"
                     /protein_id="NP_067356.2"
                     /db_xref="CCDS:CCDS20323.1"
                     /db_xref="GeneID:58182"
                     /db_xref="MGI:MGI:1929676"
                     /translation="METTVGALGENTTDTFTDFFSALDGHEAQTGSLPFTFSYGDYDM
                     PLDEEEDVTNSRTFFAAKIVIGMALVGIMLVCGIGNFIFITALARYKKLRNLTNLLIA
                     NLAISDFLVAIVCCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNALLAIAI
                     DRYLAIVHPLRPRMKCQTAAGLIFLVWSVSILIAIPAAYFTTETVLVIVERQEKIFCG
                     QIWPVDQQFYYRSYFLLVFGLEFVGPVVAMTLCYARVSRELWFKAVPGFQTEQIRRRL
                     RCRRRTVLGLVCVLSAYVLCWAPFYGFTIVRDFFPSVFVKEKHYLTAFYVVECIAMSN
                     SMINTLCFVTVRNNTSKYLKRILRLQWRASPSGSKASADLDLRTTGIPATEEVDCIRL
                     K"
     misc_feature    319..321
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q9JKL1.2); glycosylation site"
     misc_feature    475..537
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
                     transmembrane region"
     misc_feature    583..645
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
                     transmembrane region"
     misc_feature    727..789
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
                     transmembrane region"
     misc_feature    826..888
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
                     transmembrane region"
     misc_feature    985..1047
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
                     transmembrane region"
     misc_feature    1135..1197
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
                     transmembrane region"
     misc_feature    1255..1317
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKL1.2);
                     transmembrane region"
     exon            774..4098
                     /gene="Prokr1"
                     /gene_synonym="EG-VEGFR1; Gpr73; Pk-r1; Pkr1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
        1 ctctgctcag tgtgtccgtc cgccgaagta gtaggaggcc agctgccact cgagcacgga
       61 aagaccctca gaagacagag gtgctcctag cccttgctgc agagctccgg aggagcgtct
      121 gagatcctcg ctctggttcg caggttgaaa atggaactca gataccgggt cccgcagatg
      181 ctggctggaa agatctgact caccgaggga gagccaagtg cttgcagaga ggagtcgtca
      241 accttgcgga tgccagtggg actgctccag gggtgtgcac ctgcctagat ggagaccact
      301 gtcggggctc tgggtgagaa taccacagac accttcaccg acttcttttc tgcactcgat
      361 ggccatgaag cccaaaccgg ctcgttacca ttcactttca gctacggtga ctatgacatg
      421 cccctggatg aagaggaaga tgtgaccaat tctcggactt tctttgctgc caagattgtc
      481 attggcatgg ctttggtggg tatcatgcta gtgtgtggca tcggcaactt catctttatc
      541 actgccctgg cccgctacaa aaagctccgc aacctcacca acctgcttat cgccaacctg
      601 gccatttcag acttcctcgt ggccatcgtg tgctgcccct ttgagatgga ctactatgtg
      661 gtgcgccagc tctcctggga gcatggtcat gtcctgtgcg cctctgtcaa ctacttgcgt
      721 accgtctccc tctacgtctc cactaacgcc ctactggcca ttgccattga caggtatctg
      781 gccattgtgc acccgctgag accgcggatg aagtgtcaaa cagccgccgg cctgatcttc
      841 ctggtgtggt cagtatccat cctcatcgcc attccagctg cctacttcac cactgagacc
      901 gtgctggtca tcgtggagag acaggagaag atcttctgtg gtcagatctg gccggtggat
      961 cagcagttct actacaggtc ctatttcctt ttggttttcg gcctcgagtt cgtgggccct
     1021 gtagtcgcca tgaccttgtg ctatgccagg gtgtcccggg agctctggtt caaggcggtg
     1081 ccaggcttcc agacagagca gatccgccgg aggctgcgct gccgccgcag gactgtgctg
     1141 gggctcgtgt gcgtcctctc tgcctatgtg ctgtgctggg ctcccttcta tggcttcact
     1201 atcgtgcgtg acttcttccc ctccgtgttt gtgaaggaga agcactacct caccgccttc
     1261 tatgtggtgg agtgcatcgc catgagcaac agcatgatca atacgctctg ctttgtgact
     1321 gtcaggaata acaccagtaa gtacctcaag aggatcctgc ggcttcagtg gagggcctct
     1381 cccagcggga gcaaggccag cgctgacctc gacctcagga ccacgggaat acctgccacc
     1441 gaggaggtgg actgcatccg actgaaataa gcaaaatggt accacagcgc ccgggtgcac
     1501 acagcagcca tgaacttgtt tttctgcgga aggcagagga aagagacaac tacttagaca
     1561 cgctattcaa ggaccactga agtgtggaat ttctgaaatg gagacctgag atactgtcac
     1621 tagtggtcag ggttcaccga atatctaatt tttgcaaaga ctagacacca gtgaaagtcc
     1681 tttgacaaag taaagtgggg attatagcaa ggaaatatgg attggagtgt ctggaaaagg
     1741 ctatttccag agagaaggca gagcaggcta tgtaggactc tcctgtctgt gcttagggtg
     1801 gagtacaggg ctctgtgtgg gcctagctca cctctggcag gactcttggg tttttgttta
     1861 tgtctagcat tagcaagccc ggagcaagag tatggaagag gttcccagat gtgctgtagt
     1921 ccttttctgc ttacctcaga atccccactg aggggaatca gaagcatgag tggacactcc
     1981 aggacccacg gctaagttct gcgcatccac ccccaaccta cggtcagatc ttaggcctag
     2041 ggctctgcac acagacagtg ggggagggga cttctttgga gcaccgactt gagggaggag
     2101 ccacttggac tctgggtgcc atttgcatag ggaatttggg gttctgagtc ataagtttga
     2161 gttcaggtga gcatgattcc cccactcatg gtctactcac tgcaggggaa aaggaggtga
     2221 agaaggggag ggtcaggtgg gacccctgaa ggcatgcgtg caggttaaag gatgctgttg
     2281 cttcatctct cagcatctgt gccctggacc actcgtgctt cttgagactt catgcctctg
     2341 agtttatgga gcatagactc atgaaggtaa acgtagcacc ttgctgtccc gttcccacta
     2401 gctcccaaac accggtgttt tcatctcagg cagcctattt gatgggattc cctaactggt
     2461 aagactggga gaaagatttc ttaaccagtg gtacctgact cttgacctgg tcatggtcct
     2521 gggaatgaag acttgctgct ctttccaaat gaaggtgacc ttggagaaat caccacattt
     2581 ctgctcttca gcgcacatga agacttgcac atcaggggtg ctgcctggac actcaggaaa
     2641 ccgaagatga ccaacagtga gctctaggga ccccacagac ttatgaaagt ctcatcccat
     2701 gtgataactc accttcttag cttggcattt agaattctgg cctgagaaaa cctgaggcct
     2761 agctttgact aagtcatcta cacagacctg agataagact ttctaaagat aaaggtaata
     2821 cttaagaaac cttgttagaa ttgttgggag gtcaatcaaa taatctgtgg aagataagct
     2881 gttaactatc tggatagtaa agtattacca ccatttccac caccatcacc accaccacca
     2941 tctccagcac catcaccacc accaccacca ccatctccac caccaccagc agcaacagca
     3001 acaacagtga actagcaact atggagtgac tggacaaaga caaacttgta catatattct
     3061 gtttatgact ctgtcaatct aaccaacttc tctcaatgtt ctccatgtga attattttct
     3121 catgcttctc aatactgcat tgtgtcatca tagcacattg gtatcaataa gactgagaat
     3181 tttcacggca ggtacataaa ggaagtggta cccagtctcc agtcaggacg tgagcaccag
     3241 gctctgcagt ctcaggatca gagcatcctt gttgtcaggt agaagctgtt cccacacatg
     3301 cacccagaat cagagcatcc tcactggcca tcattccgca catgtcccag ccagcatgaa
     3361 caatgtctcc cagctgcttt tattctgagt gtgcagagca gcagaggggc cgggtccctc
     3421 ccctcagatt tctttatagg acaagacatt aattaaatta acctgtgtgt attttctttc
     3481 tgaatacagg caactctgtt tttgaccaca acaatttttt tagttgtcta tttcccagaa
     3541 aacacatttc aaaggaccat ttatgtattc ttattcagca tgcaacaggt tcaccttact
     3601 ttaagtcaga attctctcag agaataaaaa ttcattaatg ttcaaaccta aatcaaacac
     3661 agagaaacaa aacccctatt tttttatttt aaactttatt acaaaaaatt gcaaaaaaaa
     3721 taaaaataaa aaaggaagaa aagaaaatca cataccaaat taaccagacc aacagactct
     3781 tttttttttt taatagtaaa accccatatt gcattaaaaa tggctaagtt agtttggggt
     3841 gtaaaaatgc ttagatgaca ggatttattg ggatcatgac actgttcctc ttactaaagc
     3901 tagataagag tttgtagttg ctaaatagtt gttgattttt taaactcatg acaaattttc
     3961 ttctgatttt tctgctaaaa tgtgtcaaag tttcactttc ctaaactgtc tgtaattctt
     4021 ccagatattg gtgtctcctt gtgatttcac agtgaatgct tgttatcaaa tggaatacta
     4081 gtagatgtac acatacgaaa aaaaaaaaaa aaaaa
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.