U.S. flag

An official website of the United States government

Danio rerio tight junction protein 2b (zona occludens 2) (tjp2b), transcript variant 3, mRNA

NCBI Reference Sequence: NM_001430969.1

FASTA Graphics 

LOCUS       NM_001430969            1526 bp    mRNA    linear   VRT 16-SEP-2024
DEFINITION  Danio rerio tight junction protein 2b (zona occludens 2) (tjp2b),
            transcript variant 3, mRNA.
ACCESSION   NM_001430969
VERSION     NM_001430969.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1526)
  AUTHORS   Quint,W.H., Tadema,K.C.D., Kokke,N.C.C.J., Meester-Smoor,M.A.,
            Miller,A.C., Willemsen,R., Klaver,C.C.W. and Iglesias,A.I.
  TITLE     Post-GWAS screening of candidate genes for refractive error in
            mutant zebrafish models
  JOURNAL   Sci Rep 13 (1), 2017 (2023)
   PUBMED   36737489
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1526)
  AUTHORS   Schwayer,C., Shamipour,S., Pranjic-Ferscha,K., Schauer,A.,
            Balda,M., Tada,M., Matter,K. and Heisenberg,C.P.
  TITLE     Mechanosensation of Tight Junctions Depends on ZO-1 Phase
            Separation and Flow
  JOURNAL   Cell 179 (4), 937-952 (2019)
   PUBMED   31675500
REFERENCE   3  (bases 1 to 1526)
  AUTHORS   Rodel,C.J., Otten,C., Donat,S., Lourenco,M., Fischer,D.,
            Kuropka,B., Paolini,A., Freund,C. and Abdelilah-Seyfried,S.
  TITLE     Blood Flow Suppresses Vascular Anomalies in a Zebrafish Model of
            Cerebral Cavernous Malformations
  JOURNAL   Circ Res 125 (10), e43-e54 (2019)
   PUBMED   31495257
REFERENCE   4  (bases 1 to 1526)
  AUTHORS   Lin,X., Zhou,Q., Zhao,C., Lin,G., Xu,J. and Wen,Z.
  TITLE     An Ectoderm-Derived Myeloid-like Cell Population Functions as
            Antigen Transporters for Langerhans Cells in Zebrafish Epidermis
  JOURNAL   Dev Cell 49 (4), 605-617 (2019)
   PUBMED   31006648
REFERENCE   5  (bases 1 to 1526)
  AUTHORS   Bayes,A., Collins,M.O., Reig-Viader,R., Gou,G., Goulding,D.,
            Izquierdo,A., Choudhary,J.S., Emes,R.D. and Grant,S.G.
  TITLE     Evolution of complexity in the zebrafish synapse proteome
  JOURNAL   Nat Commun 8, 14613 (2017)
   PUBMED   28252024
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1526)
  AUTHORS   Varshney,G.K., Pei,W., LaFave,M.C., Idol,J., Xu,L., Gallardo,V.,
            Carrington,B., Bishop,K., Jones,M., Li,M., Harper,U., Huang,S.C.,
            Prakash,A., Chen,W., Sood,R., Ledin,J. and Burgess,S.M.
  TITLE     High-throughput gene targeting and phenotyping in zebrafish using
            CRISPR/Cas9
  JOURNAL   Genome Res 25 (7), 1030-1042 (2015)
   PUBMED   26048245
REFERENCE   7  (bases 1 to 1526)
  AUTHORS   Shah,A.N., Davey,C.F., Whitebirch,A.C., Miller,A.C. and Moens,C.B.
  TITLE     Rapid reverse genetic screening using CRISPR in zebrafish
  JOURNAL   Nat Methods 12 (6), 535-540 (2015)
   PUBMED   25867848
REFERENCE   8  (bases 1 to 1526)
  AUTHORS   McKee,R., Gerlach,G.F., Jou,J., Cheng,C.N. and Wingert,R.A.
  TITLE     Temporal and spatial expression of tight junction genes during
            zebrafish pronephros development
  JOURNAL   Gene Expr Patterns 16 (2), 104-113 (2014)
   PUBMED   25460834
REFERENCE   9  (bases 1 to 1526)
  AUTHORS   Zou,J., Li,W.Q., Li,Q., Li,X.Q., Zhang,J.T., Liu,G.Q., Chen,J.,
            Qiu,X.X., Tian,F.J., Wang,Z.Z., Zhu,N., Qin,Y.W., Shen,B., Liu,T.X.
            and Jing,Q.
  TITLE     Two functional microRNA-126s repress a novel target gene
            p21-activated kinase 1 to regulate vascular integrity in zebrafish
  JOURNAL   Circ Res 108 (2), 201-209 (2011)
   PUBMED   21148433
  REMARK    Erratum:[Circ Res. 2011 Mar 4;108(5):e10]
REFERENCE   10 (bases 1 to 1526)
  AUTHORS   Kiener,T.K., Sleptsova-Friedrich,I. and Hunziker,W.
  TITLE     Identification, tissue distribution and developmental expression of
            tjp1/zo-1, tjp2/zo-2 and tjp3/zo-3 in the zebrafish, Danio rerio
  JOURNAL   Gene Expr Patterns 7 (7), 767-776 (2007)
   PUBMED   17632043
  REMARK    GeneRIF: analysis of tissue distribution and developmental
            expression of tjp1/zo-1, tjp2/zo-2 and tjp3/zo-3 in the zebrafish,
            Danio rerio
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            FQ377600.4 and CR361566.16.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA3505370,
                              SAMEA3505373 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            CDS uses downstream in-frame AUG :: lack of evidence for use of
                                                upstream AUG
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-181               FQ377600.4         1423-1603           c
            182-235             CR361566.16        6037-6090
            236-360             CR361566.16        12171-12295
            361-463             CR361566.16        14575-14677
            464-1076            CR361566.16        17506-18118
            1077-1180           CR361566.16        23067-23170
            1181-1334           CR361566.16        25891-26044
            1335-1526           CR361566.16        28336-28527
FEATURES             Location/Qualifiers
     source          1..1526
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="8"
                     /map="8"
     gene            1..1526
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /note="tight junction protein 2b (zona occludens 2)"
                     /db_xref="GeneID:436639"
                     /db_xref="ZFIN:ZDB-GENE-040718-58"
     exon            1..181
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    110..112
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /note="upstream in-frame stop codon"
     misc_feature    155..157
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /note="upstream_AUG_codon; putative N-terminal extension:
                     M"
     CDS             158..1360
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /note="isoform 3 is encoded by transcript variant 3; zona
                     occludens 2; tjp2.2; zo-2.2"
                     /codon_start=1
                     /product="tight junction protein ZO-2b isoform 3"
                     /protein_id="NP_001417898.1"
                     /db_xref="GeneID:436639"
                     /db_xref="ZFIN:ZDB-GENE-040718-58"
                     /translation="MAVRFLHQSSGMEETVWEQYTVTLQRDAKMGFGIAVSGGRDNPN
                     VESGETSIIVSDVLPGGPADGLLFENDRVIQVNTIAMNNVPHSFAVQSLRKCGKVAKI
                     TVKRPRKVAVLKRPPSPSGDSRDYNISSYYPEDSRSVHSDPDSDYPRGNGGLGYPRDR
                     ERDRSLDKSRIDYLDPDYRSQDYDSRRERSRGRSTDRSPSTDSGYRRDGSRGRTLERG
                     SSPEPRYQRQHSRGRGGGSPAGSYSRDQGYDTRRYDTQDRMIRSHSRDRLQDHSPSPS
                     RERDRGRDRFNYEPLEPPVNVTLVKNRPNEEYGLRLGSQIFIKEMTSTGLAARDGNLQ
                     EGDIILKINGTVTENLSLSDAGKLIEKSRGKLQLVVQRDHRQILVRIPALADSDSEPD
                     DNTDMSYF"
     exon            182..235
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /inference="alignment:Splign:2.1.0"
     exon            236..360
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /inference="alignment:Splign:2.1.0"
     exon            361..463
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /inference="alignment:Splign:2.1.0"
     exon            464..1076
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /inference="alignment:Splign:2.1.0"
     exon            1077..1180
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /inference="alignment:Splign:2.1.0"
     exon            1181..1334
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /inference="alignment:Splign:2.1.0"
     exon            1335..1526
                     /gene="tjp2b"
                     /gene_synonym="fb62b09; wu:fb62b09; zgc:92094"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
        1 atgcaaagca ttgtgggaag tatacaggtg taatgcgcta ccttcttatc atttgtttgt
       61 tttgttttaa cgcgattact cagcaaaagg gaggaatgtg gatattcgat gagcccggat
      121 ctgttcaagc gctcgacttg agaaatgctg cgcaatgatg gctgttaggt ttctgcatca
      181 gagctcagga atggaggaga cggtttggga gcagtacact gtgactctac agcgggacgc
      241 taagatgggc tttggaattg ctgtgtccgg cggccgggac aatccaaacg tggagagcgg
      301 ggagacgtcc atcatcgtgt cagacgtgct gccaggagga ccggccgatg gactgctctt
      361 tgagaacgac cgtgtgatac aggtcaacac catcgccatg aataatgtgc ctcattcttt
      421 cgctgtgcag tcacttcgga aatgtgggaa agtggccaaa ataactgtaa aaaggcctcg
      481 caaggtggct gtcctcaagc gcccgccgtc cccgagcggg gatagccgtg attacaacat
      541 ttccagttat tatcctgagg acagccgcag tgtgcacagt gacccagact cagattaccc
      601 tcggggaaac ggcggtctgg gctacccccg tgaccgagag cgtgaccgca gcctcgataa
      661 gagccggata gactacctag atccggatta ccgcagccag gactatgact cccggcgcga
      721 gcgaagccga ggcaggagca cggatagatc ccccagcact gacagtgggt accggaggga
      781 cggcagcagg ggccggacgc tggagcgcgg gtctagcccg gagcctcgat atcaacggca
      841 gcacagcaga ggccgcggtg gaggaagccc tgctggaagc tatagccggg accagggcta
      901 cgacacgcgg aggtatgaca cgcaggacag gatgatcagg agtcacagca gggaccggtt
      961 gcaggatcac tcgccctcgc ccagcagaga gcgggacagg ggaagagacc ggtttaacta
     1021 tgagcccctg gagccacccg tcaatgtgac gctggtcaaa aacaggccca atgaagagta
     1081 cggcctccgc ctgggcagcc agatcttcat caaagagatg accagcactg gacttgctgc
     1141 ccgagatgga aatctccagg agggcgatat cattctcaag atcaacggga cggtgacgga
     1201 aaacctctct ctgagtgacg ctggcaaact gatcgagaaa tcccgaggca aacttcagct
     1261 tgtggtccag agagaccatc ggcaaatcct ggtgcgcatc cctgccctcg ccgacagcga
     1321 ctcggagccg gacgataata cagatatgtc atacttttag ctgatggacc gcagagacac
     1381 aacataaagt ctggttgcct ttaatcttta atcatgattg tgcctcaaca aatctgtaaa
     1441 gccttaacac tgtgctctca tatttttatg ctaacctctt tttttaaaag cttcttttaa
     1501 tcaataaata agtctgctca atttta
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.