LOCUS NM_001345485 979 bp mRNA linear PLN 20-OCT-2022
DEFINITION Arabidopsis thaliana peptidemethionine sulfoxide reductase 1
(PMSR1), mRNA.
ACCESSION NM_001345485
VERSION NM_001345485.1
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 979)
AUTHORS Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
CONSRTM Kazusa DNA Research Institute; Cold Spring Harbor and Washington
University in St Louis Sequencing Consortium; European Union
Arabidopsis Genome Sequencing Consortium
TITLE Sequence and analysis of chromosome 5 of the plant Arabidopsis
thaliana
JOURNAL Nature 408 (6814), 823-826 (2000)
PUBMED 11130714
REFERENCE 2 (bases 1 to 979)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 979)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 979)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
This record is derived from an annotated genomic sequence
(NC_003076).
FEATURES Location/Qualifiers
source 1..979
/organism="Arabidopsis thaliana"
/mol_type="mRNA"
/db_xref="taxon:3702"
/chromosome="5"
/ecotype="Columbia"
gene 1..979
/gene="PMSR1"
/locus_tag="AT5G61640"
/gene_synonym="ARABIDOPSIS THALIANA METHIONINE SULFOXIDE
REDUCTASE A1; ATMSRA1; K11J9.18; K11J9_18;
peptidemethionine sulfoxide reductase 1"
/note="ubiquitous enzyme that repairs oxidatively damaged
proteins"
/db_xref="Araport:AT5G61640"
/db_xref="GeneID:836286"
/db_xref="TAIR:AT5G61640"
CDS 47..736
/gene="PMSR1"
/locus_tag="AT5G61640"
/gene_synonym="ARABIDOPSIS THALIANA METHIONINE SULFOXIDE
REDUCTASE A1; ATMSRA1; K11J9.18; K11J9_18;
peptidemethionine sulfoxide reductase 1"
/codon_start=1
/product="peptidemethionine sulfoxide reductase 1"
/protein_id="NP_001331838.1"
/db_xref="GeneID:836286"
/db_xref="Araport:AT5G61640"
/db_xref="TAIR:AT5G61640"
/translation="MFRRISRRFLFTTFLCFSVSLSLQNFSMNILNKLGIGSSRQTNM
DPSPIAQVIDDEAPAPGNQFTQFGAGCFWSVELAYQRVPGVTQTEVGYSQGITHDPSY
KDVCSGTTNHAEIVRVQYDPKECSYQSLLDLFWSKHDPTTLNRQGNDVGTQYRSGIYF
YNPEQEKLARESLERHQQQVDRKVVTEILPAKKFYRAEEHHQQYLSKGGRFGLKQSTE
KGCNDPIRCYG"
ORIGIN
1 cgtaaacgca aacgcgaatt ttatacctgt cagaatttgg tacaaaatgt tccgcagaat
61 cagccgacgt ttcctcttca ccactttcct ctgtttctct gtttcgctct ctctacaaaa
121 tttctccatg aacatactta acaagctagg tataggatca agtagacaaa ccaacatgga
181 tccttctcca atcgcacaag taatcgacga cgaagctccg gcgccgggaa accagtttac
241 tcaattcggc gccggttgtt tctggagcgt ggaattagcg taccagagag ttccaggagt
301 gactcaaaca gaggttggtt attctcaagg gatcactcac gatccttctt acaaagatgt
361 ttgttcaggt accacgaatc atgccgagat tgttcgtgtt caatatgatc caaaagagtg
421 tagttaccag tcgctgcttg atttgttctg gtctaagcat gatcccacca ctttgaatcg
481 gcagggaaat gatgtgggaa cccaataccg ttcagggata tatttctaca acccggagca
541 agagaaacta gcacgcgagt cactggagcg gcaccagcaa caagttgaca ggaaggttgt
601 gacagagatc ttaccggcta agaaatttta tagagctgag gaacatcacc agcaatactt
661 gtctaaagga gggaggtttg gtcttaagca atcaacggaa aaaggctgca acgacccaat
721 ccgctgctac gggtaaaagc cttgcttcta accgaaagca gaggatgctt ccacttatct
781 atgatagatt atagcaatta tcgttgaaaa ataaagaagc cgaggctact tatgtaactt
841 gttcttgttc ataaaacttt ttaagtgttc aatcctttag gtatatagta ttgtttggat
901 gttctcgatt gaatttgttc ttgtaagatt catcaaaact agtttgagta aaacgtaaaa
961 tgatttttta gtgtctttt
//