U.S. flag

An official website of the United States government

Arabidopsis thaliana peptidemethionine sulfoxide reductase 1 (PMSR1), mRNA

NCBI Reference Sequence: NM_001345485.1

FASTA Graphics 

LOCUS       NM_001345485             979 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana peptidemethionine sulfoxide reductase 1
            (PMSR1), mRNA.
ACCESSION   NM_001345485
VERSION     NM_001345485.1
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 979)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 979)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 979)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 979)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
FEATURES             Location/Qualifiers
     source          1..979
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..979
                     /gene="PMSR1"
                     /locus_tag="AT5G61640"
                     /gene_synonym="ARABIDOPSIS THALIANA METHIONINE SULFOXIDE
                     REDUCTASE A1; ATMSRA1; K11J9.18; K11J9_18;
                     peptidemethionine sulfoxide reductase 1"
                     /note="ubiquitous enzyme that repairs oxidatively damaged
                     proteins"
                     /db_xref="Araport:AT5G61640"
                     /db_xref="GeneID:836286"
                     /db_xref="TAIR:AT5G61640"
     CDS             47..736
                     /gene="PMSR1"
                     /locus_tag="AT5G61640"
                     /gene_synonym="ARABIDOPSIS THALIANA METHIONINE SULFOXIDE
                     REDUCTASE A1; ATMSRA1; K11J9.18; K11J9_18;
                     peptidemethionine sulfoxide reductase 1"
                     /codon_start=1
                     /product="peptidemethionine sulfoxide reductase 1"
                     /protein_id="NP_001331838.1"
                     /db_xref="GeneID:836286"
                     /db_xref="Araport:AT5G61640"
                     /db_xref="TAIR:AT5G61640"
                     /translation="MFRRISRRFLFTTFLCFSVSLSLQNFSMNILNKLGIGSSRQTNM
                     DPSPIAQVIDDEAPAPGNQFTQFGAGCFWSVELAYQRVPGVTQTEVGYSQGITHDPSY
                     KDVCSGTTNHAEIVRVQYDPKECSYQSLLDLFWSKHDPTTLNRQGNDVGTQYRSGIYF
                     YNPEQEKLARESLERHQQQVDRKVVTEILPAKKFYRAEEHHQQYLSKGGRFGLKQSTE
                     KGCNDPIRCYG"
ORIGIN      
        1 cgtaaacgca aacgcgaatt ttatacctgt cagaatttgg tacaaaatgt tccgcagaat
       61 cagccgacgt ttcctcttca ccactttcct ctgtttctct gtttcgctct ctctacaaaa
      121 tttctccatg aacatactta acaagctagg tataggatca agtagacaaa ccaacatgga
      181 tccttctcca atcgcacaag taatcgacga cgaagctccg gcgccgggaa accagtttac
      241 tcaattcggc gccggttgtt tctggagcgt ggaattagcg taccagagag ttccaggagt
      301 gactcaaaca gaggttggtt attctcaagg gatcactcac gatccttctt acaaagatgt
      361 ttgttcaggt accacgaatc atgccgagat tgttcgtgtt caatatgatc caaaagagtg
      421 tagttaccag tcgctgcttg atttgttctg gtctaagcat gatcccacca ctttgaatcg
      481 gcagggaaat gatgtgggaa cccaataccg ttcagggata tatttctaca acccggagca
      541 agagaaacta gcacgcgagt cactggagcg gcaccagcaa caagttgaca ggaaggttgt
      601 gacagagatc ttaccggcta agaaatttta tagagctgag gaacatcacc agcaatactt
      661 gtctaaagga gggaggtttg gtcttaagca atcaacggaa aaaggctgca acgacccaat
      721 ccgctgctac gggtaaaagc cttgcttcta accgaaagca gaggatgctt ccacttatct
      781 atgatagatt atagcaatta tcgttgaaaa ataaagaagc cgaggctact tatgtaactt
      841 gttcttgttc ataaaacttt ttaagtgttc aatcctttag gtatatagta ttgtttggat
      901 gttctcgatt gaatttgttc ttgtaagatt catcaaaact agtttgagta aaacgtaaaa
      961 tgatttttta gtgtctttt
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

More about the PMSR1 gene

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.