U.S. flag

An official website of the United States government

Homo sapiens RNA polymerase II, I and III subunit H (POLR2H), transcript variant 6, mRNA

NCBI Reference Sequence: NM_001278715.2

FASTA Graphics 

LOCUS       NM_001278715             807 bp    mRNA    linear   PRI 13-APR-2024
DEFINITION  Homo sapiens RNA polymerase II, I and III subunit H (POLR2H),
            transcript variant 6, mRNA.
ACCESSION   NM_001278715
VERSION     NM_001278715.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 807)
  AUTHORS   Daiss,J.L., Pilsl,M., Straub,K., Bleckmann,A., Hocherl,M.,
            Heiss,F.B., Abascal-Palacios,G., Ramsay,E.P., Tluckova,K.,
            Mars,J.C., Furtges,T., Bruckmann,A., Rudack,T., Bernecky,C.,
            Lamour,V., Panov,K., Vannini,A., Moss,T. and Engel,C.
  TITLE     The human RNA polymerase I structure reveals an HMG-like docking
            domain specific to metazoans
  JOURNAL   Life Sci Alliance 5 (11), e202201568 (2022)
   PUBMED   36271492
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 807)
  AUTHORS   Hou,H., Li,Y., Wang,M., Liu,A., Yu,Z., Chen,K., Zhao,D. and Xu,Y.
  TITLE     Structural insights into RNA polymerase III-mediated transcription
            termination through trapping poly-deoxythymidine
  JOURNAL   Nat Commun 12 (1), 6135 (2021)
   PUBMED   34675218
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 807)
  AUTHORS   Zhao,D., Liu,W., Chen,K., Wu,Z., Yang,H. and Xu,Y.
  TITLE     Structure of the human RNA polymerase I elongation complex
  JOURNAL   Cell Discov 7 (1), 97 (2021)
   PUBMED   34671025
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 807)
  AUTHORS   Ramsay,E.P., Abascal-Palacios,G., Daiss,J.L., King,H., Gouge,J.,
            Pilsl,M., Beuron,F., Morris,E., Gunkel,P., Engel,C. and Vannini,A.
  TITLE     Structure of human RNA polymerase III
  JOURNAL   Nat Commun 11 (1), 6409 (2020)
   PUBMED   33335104
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 807)
  AUTHORS   Paulsen,T., Shibata,Y., Kumar,P., Dillon,L. and Dutta,A.
  TITLE     Small extrachromosomal circular DNAs, microDNA, produce short
            regulatory RNAs that suppress gene expression independent of
            canonical promoters
  JOURNAL   Nucleic Acids Res 47 (9), 4586-4596 (2019)
   PUBMED   30828735
  REMARK    GeneRIF: We also show that endogenous microDNA associate with RNA
            polymerases subunits, POLR2H and POLR3F. Together, these results
            suggest that microDNA may modulate gene expression through the
            production of both known and novel regulatory small RNA.
REFERENCE   6  (bases 1 to 807)
  AUTHORS   Kato,H., Sumimoto,H., Pognonec,P., Chen,C.H., Rosen,C.A. and
            Roeder,R.G.
  TITLE     HIV-1 Tat acts as a processivity factor in vitro in conjunction
            with cellular elongation factors
  JOURNAL   Genes Dev 6 (4), 655-666 (1992)
   PUBMED   1559613
REFERENCE   7  (bases 1 to 807)
  AUTHORS   Jang,K.L., Collins,M.K. and Latchman,D.S.
  TITLE     The human immunodeficiency virus tat protein increases the
            transcription of human Alu repeated sequences by increasing the
            activity of the cellular transcription factor TFIIIC
  JOURNAL   J Acquir Immune Defic Syndr (1988) 5 (11), 1142-1147 (1992)
   PUBMED   1403646
REFERENCE   8  (bases 1 to 807)
  AUTHORS   Jacob,G.A., Luse,S.W. and Luse,D.S.
  TITLE     Abortive initiation is increased only for the weakest members of a
            set of down mutants of the adenovirus 2 major late promoter
  JOURNAL   J Biol Chem 266 (33), 22537-22544 (1991)
   PUBMED   1939271
REFERENCE   9  (bases 1 to 807)
  AUTHORS   Southgate,C., Zapp,M.L. and Green,M.R.
  TITLE     Activation of transcription by HIV-1 Tat protein tethered to
            nascent RNA through another protein
  JOURNAL   Nature 345 (6276), 640-642 (1990)
   PUBMED   2190099
REFERENCE   10 (bases 1 to 807)
  AUTHORS   Conaway,R.C. and Conaway,J.W.
  TITLE     ATP activates transcription initiation from promoters by RNA
            polymerase II in a reversible step prior to RNA synthesis
  JOURNAL   J Biol Chem 263 (6), 2962-2968 (1988)
   PUBMED   2449431
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CN368789.1, BI603667.1,
            BQ065952.1, Z49199.1, AA431357.1 and BX283032.1.
            
            On Aug 13, 2020 this sequence version replaced NM_001278715.1.
            
            Summary: The three eukaryotic RNA polymerases are complex
            multisubunit enzymes that play a central role in the transcription
            of nuclear genes. This gene encodes an essential and highly
            conserved subunit of RNA polymerase II that is shared by the other
            two eukaryotic DNA-directed RNA polymerases, I and III. Alternative
            splicing results in multiple transcript variants of this gene.
            [provided by RefSeq, Jul 2013].
            
            Transcript Variant: This variant (6) differs in the 5' UTR and has
            multiple coding region differences compared to variant 1, one of
            which results in a frameshift. It encodes isoform 5 which is
            shorter and has a distinct C-terminus, compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BI603667.1, CN368785.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-4                 CN368789.1         383-386
            5-286               BI603667.1         10-291
            287-359             BQ065952.1         223-295
            360-638             BI603667.1         365-643
            639-791             Z49199.1           660-812
            792-801             AA431357.1         17-26               c
            802-807             BX283032.1         474-479
FEATURES             Location/Qualifiers
     source          1..807
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="3"
                     /map="3q27.1"
     gene            1..807
                     /gene="POLR2H"
                     /gene_synonym="RPABC3; RPB17; RPB8"
                     /note="RNA polymerase II, I and III subunit H"
                     /db_xref="GeneID:5437"
                     /db_xref="HGNC:HGNC:9195"
                     /db_xref="MIM:606023"
     exon            1..214
                     /gene="POLR2H"
                     /gene_synonym="RPABC3; RPB17; RPB8"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    211..213
                     /gene="POLR2H"
                     /gene_synonym="RPABC3; RPB17; RPB8"
                     /note="upstream in-frame stop codon"
     exon            215..298
                     /gene="POLR2H"
                     /gene_synonym="RPABC3; RPB17; RPB8"
                     /inference="alignment:Splign:2.1.0"
     CDS             250..510
                     /gene="POLR2H"
                     /gene_synonym="RPABC3; RPB17; RPB8"
                     /EC_number="2.7.7.6"
                     /note="isoform 5 is encoded by transcript variant 6;
                     DNA-directed RNA polymerases I, II, and III subunit
                     RPABC3; RPB8 homolog; DNA-directed RNA polymerase II
                     subunit H; DNA-directed RNA polymerases I, II, and III
                     17.1 kDa polypeptide; polymerase (RNA) II (DNA directed)
                     polypeptide H; polymerase (RNA) II subunit H"
                     /codon_start=1
                     /product="DNA-directed RNA polymerases I, II, and III
                     subunit RPABC3 isoform 5"
                     /protein_id="NP_001265644.1"
                     /db_xref="CCDS:CCDS63862.1"
                     /db_xref="GeneID:5437"
                     /db_xref="HGNC:HGNC:9195"
                     /db_xref="MIM:606023"
                     /translation="MDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDD
                     RPSSSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF"
     exon            299..392
                     /gene="POLR2H"
                     /gene_synonym="RPABC3; RPB17; RPB8"
                     /inference="alignment:Splign:2.1.0"
     exon            393..807
                     /gene="POLR2H"
                     /gene_synonym="RPABC3; RPB17; RPB8"
                     /inference="alignment:Splign:2.1.0"
     regulatory      734..739
                     /regulatory_class="polyA_signal_sequence"
                     /gene="POLR2H"
                     /gene_synonym="RPABC3; RPB17; RPB8"
                     /note="hexamer: ATTAAA"
     polyA_site      764
                     /gene="POLR2H"
                     /gene_synonym="RPABC3; RPB17; RPB8"
     polyA_site      807
                     /gene="POLR2H"
                     /gene_synonym="RPABC3; RPB17; RPB8"
                     /note="major polyA site"
ORIGIN      
        1 actctcgtct ggccgccgcg ctttcaggag gtgcttttgg ttctctccgg tcttgtccac
       61 gctagggggt gcacgtactc ccaactgtgg tcgcgctctc accccttctg ctgctctcgt
      121 ggccccctcg cgatggcggg catcctgttt gaggatattt tcgatgtgaa ggatattgac
      181 ccggagggca agaagtttga ccgaggtaag taagtgtctc gactgcattg tgagagtgaa
      241 tctttcaaga tggatctaat cttagatgta aacattcaaa tttaccctgt agacttgggt
      301 gacaagtttc ggttggtcat agctagtacc ttgtatgaag atggtaccct ggatgatggt
      361 gaatacaacc ccactgatga taggccttcc agctctgcgt acgtgtccta tgggggcctg
      421 ctcatgaggc tgcaggggga tgccaacaac ctgcatggat tcgaggtgga ctccagagtt
      481 tatctcctga tgaagaagct agccttctga acctcgcctg aagccagcct ctctgccaag
      541 tcactcaggt catgggcatt gttcaagcct gagtggcagc cgctcttgct cacctgttga
      601 ggaagggctg gctcactgtc caccgtggcg gcatctttaa ctggcctcca ctcaatggga
      661 aactgactcg cctgtgaaag acacagtggg agagctgaaa atgaatcaga agctttatgt
      721 atatgatttt taaattaaac tttacttttt cagactgccc ctcccctttt tgtaaaaagt
      781 ccatttactg taaaatcgtt ttttcca
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq alternative splicing
    See 30 reference mRNA sequence splice variants for the POLR2H gene.
  • RefSeq protein product
    See the reference protein sequence for DNA-directed RNA polymerases I, II, and III subunit RPABC3 isoform 5 (NP_001265644.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.