LOCUS NM_001278715 807 bp mRNA linear PRI 13-APR-2024
DEFINITION Homo sapiens RNA polymerase II, I and III subunit H (POLR2H),
transcript variant 6, mRNA.
ACCESSION NM_001278715
VERSION NM_001278715.2
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 807)
AUTHORS Daiss,J.L., Pilsl,M., Straub,K., Bleckmann,A., Hocherl,M.,
Heiss,F.B., Abascal-Palacios,G., Ramsay,E.P., Tluckova,K.,
Mars,J.C., Furtges,T., Bruckmann,A., Rudack,T., Bernecky,C.,
Lamour,V., Panov,K., Vannini,A., Moss,T. and Engel,C.
TITLE The human RNA polymerase I structure reveals an HMG-like docking
domain specific to metazoans
JOURNAL Life Sci Alliance 5 (11), e202201568 (2022)
PUBMED 36271492
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 807)
AUTHORS Hou,H., Li,Y., Wang,M., Liu,A., Yu,Z., Chen,K., Zhao,D. and Xu,Y.
TITLE Structural insights into RNA polymerase III-mediated transcription
termination through trapping poly-deoxythymidine
JOURNAL Nat Commun 12 (1), 6135 (2021)
PUBMED 34675218
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 807)
AUTHORS Zhao,D., Liu,W., Chen,K., Wu,Z., Yang,H. and Xu,Y.
TITLE Structure of the human RNA polymerase I elongation complex
JOURNAL Cell Discov 7 (1), 97 (2021)
PUBMED 34671025
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 807)
AUTHORS Ramsay,E.P., Abascal-Palacios,G., Daiss,J.L., King,H., Gouge,J.,
Pilsl,M., Beuron,F., Morris,E., Gunkel,P., Engel,C. and Vannini,A.
TITLE Structure of human RNA polymerase III
JOURNAL Nat Commun 11 (1), 6409 (2020)
PUBMED 33335104
REMARK Publication Status: Online-Only
REFERENCE 5 (bases 1 to 807)
AUTHORS Paulsen,T., Shibata,Y., Kumar,P., Dillon,L. and Dutta,A.
TITLE Small extrachromosomal circular DNAs, microDNA, produce short
regulatory RNAs that suppress gene expression independent of
canonical promoters
JOURNAL Nucleic Acids Res 47 (9), 4586-4596 (2019)
PUBMED 30828735
REMARK GeneRIF: We also show that endogenous microDNA associate with RNA
polymerases subunits, POLR2H and POLR3F. Together, these results
suggest that microDNA may modulate gene expression through the
production of both known and novel regulatory small RNA.
REFERENCE 6 (bases 1 to 807)
AUTHORS Kato,H., Sumimoto,H., Pognonec,P., Chen,C.H., Rosen,C.A. and
Roeder,R.G.
TITLE HIV-1 Tat acts as a processivity factor in vitro in conjunction
with cellular elongation factors
JOURNAL Genes Dev 6 (4), 655-666 (1992)
PUBMED 1559613
REFERENCE 7 (bases 1 to 807)
AUTHORS Jang,K.L., Collins,M.K. and Latchman,D.S.
TITLE The human immunodeficiency virus tat protein increases the
transcription of human Alu repeated sequences by increasing the
activity of the cellular transcription factor TFIIIC
JOURNAL J Acquir Immune Defic Syndr (1988) 5 (11), 1142-1147 (1992)
PUBMED 1403646
REFERENCE 8 (bases 1 to 807)
AUTHORS Jacob,G.A., Luse,S.W. and Luse,D.S.
TITLE Abortive initiation is increased only for the weakest members of a
set of down mutants of the adenovirus 2 major late promoter
JOURNAL J Biol Chem 266 (33), 22537-22544 (1991)
PUBMED 1939271
REFERENCE 9 (bases 1 to 807)
AUTHORS Southgate,C., Zapp,M.L. and Green,M.R.
TITLE Activation of transcription by HIV-1 Tat protein tethered to
nascent RNA through another protein
JOURNAL Nature 345 (6276), 640-642 (1990)
PUBMED 2190099
REFERENCE 10 (bases 1 to 807)
AUTHORS Conaway,R.C. and Conaway,J.W.
TITLE ATP activates transcription initiation from promoters by RNA
polymerase II in a reversible step prior to RNA synthesis
JOURNAL J Biol Chem 263 (6), 2962-2968 (1988)
PUBMED 2449431
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from CN368789.1, BI603667.1,
BQ065952.1, Z49199.1, AA431357.1 and BX283032.1.
On Aug 13, 2020 this sequence version replaced NM_001278715.1.
Summary: The three eukaryotic RNA polymerases are complex
multisubunit enzymes that play a central role in the transcription
of nuclear genes. This gene encodes an essential and highly
conserved subunit of RNA polymerase II that is shared by the other
two eukaryotic DNA-directed RNA polymerases, I and III. Alternative
splicing results in multiple transcript variants of this gene.
[provided by RefSeq, Jul 2013].
Transcript Variant: This variant (6) differs in the 5' UTR and has
multiple coding region differences compared to variant 1, one of
which results in a frameshift. It encodes isoform 5 which is
shorter and has a distinct C-terminus, compared to isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BI603667.1, CN368785.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA1965299, SAMEA1966682
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-4 CN368789.1 383-386
5-286 BI603667.1 10-291
287-359 BQ065952.1 223-295
360-638 BI603667.1 365-643
639-791 Z49199.1 660-812
792-801 AA431357.1 17-26 c
802-807 BX283032.1 474-479
FEATURES Location/Qualifiers
source 1..807
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="3"
/map="3q27.1"
gene 1..807
/gene="POLR2H"
/gene_synonym="RPABC3; RPB17; RPB8"
/note="RNA polymerase II, I and III subunit H"
/db_xref="GeneID:5437"
/db_xref="HGNC:HGNC:9195"
/db_xref="MIM:606023"
exon 1..214
/gene="POLR2H"
/gene_synonym="RPABC3; RPB17; RPB8"
/inference="alignment:Splign:2.1.0"
misc_feature 211..213
/gene="POLR2H"
/gene_synonym="RPABC3; RPB17; RPB8"
/note="upstream in-frame stop codon"
exon 215..298
/gene="POLR2H"
/gene_synonym="RPABC3; RPB17; RPB8"
/inference="alignment:Splign:2.1.0"
CDS 250..510
/gene="POLR2H"
/gene_synonym="RPABC3; RPB17; RPB8"
/EC_number="2.7.7.6"
/note="isoform 5 is encoded by transcript variant 6;
DNA-directed RNA polymerases I, II, and III subunit
RPABC3; RPB8 homolog; DNA-directed RNA polymerase II
subunit H; DNA-directed RNA polymerases I, II, and III
17.1 kDa polypeptide; polymerase (RNA) II (DNA directed)
polypeptide H; polymerase (RNA) II subunit H"
/codon_start=1
/product="DNA-directed RNA polymerases I, II, and III
subunit RPABC3 isoform 5"
/protein_id="NP_001265644.1"
/db_xref="CCDS:CCDS63862.1"
/db_xref="GeneID:5437"
/db_xref="HGNC:HGNC:9195"
/db_xref="MIM:606023"
/translation="MDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDD
RPSSSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF"
exon 299..392
/gene="POLR2H"
/gene_synonym="RPABC3; RPB17; RPB8"
/inference="alignment:Splign:2.1.0"
exon 393..807
/gene="POLR2H"
/gene_synonym="RPABC3; RPB17; RPB8"
/inference="alignment:Splign:2.1.0"
regulatory 734..739
/regulatory_class="polyA_signal_sequence"
/gene="POLR2H"
/gene_synonym="RPABC3; RPB17; RPB8"
/note="hexamer: ATTAAA"
polyA_site 764
/gene="POLR2H"
/gene_synonym="RPABC3; RPB17; RPB8"
polyA_site 807
/gene="POLR2H"
/gene_synonym="RPABC3; RPB17; RPB8"
/note="major polyA site"
ORIGIN
1 actctcgtct ggccgccgcg ctttcaggag gtgcttttgg ttctctccgg tcttgtccac
61 gctagggggt gcacgtactc ccaactgtgg tcgcgctctc accccttctg ctgctctcgt
121 ggccccctcg cgatggcggg catcctgttt gaggatattt tcgatgtgaa ggatattgac
181 ccggagggca agaagtttga ccgaggtaag taagtgtctc gactgcattg tgagagtgaa
241 tctttcaaga tggatctaat cttagatgta aacattcaaa tttaccctgt agacttgggt
301 gacaagtttc ggttggtcat agctagtacc ttgtatgaag atggtaccct ggatgatggt
361 gaatacaacc ccactgatga taggccttcc agctctgcgt acgtgtccta tgggggcctg
421 ctcatgaggc tgcaggggga tgccaacaac ctgcatggat tcgaggtgga ctccagagtt
481 tatctcctga tgaagaagct agccttctga acctcgcctg aagccagcct ctctgccaag
541 tcactcaggt catgggcatt gttcaagcct gagtggcagc cgctcttgct cacctgttga
601 ggaagggctg gctcactgtc caccgtggcg gcatctttaa ctggcctcca ctcaatggga
661 aactgactcg cctgtgaaag acacagtggg agagctgaaa atgaatcaga agctttatgt
721 atatgatttt taaattaaac tttacttttt cagactgccc ctcccctttt tgtaaaaagt
781 ccatttactg taaaatcgtt ttttcca
//