LOCUS NM_001271277 997 bp mRNA linear ROD 26-FEB-2024
DEFINITION Rattus norvegicus titin-cap (Tcap), mRNA.
ACCESSION NM_001271277 XM_001081394
VERSION NM_001271277.1
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 997)
AUTHORS Candasamy AJ, Haworth RS, Cuello F, Ibrahim M, Aravamudhan S,
Kruger M, Holt MR, Terracciano CM, Mayr M, Gautel M and Avkiran M.
TITLE Phosphoregulation of the titin-cap protein telethonin in cardiac
myocytes
JOURNAL J Biol Chem 289 (3), 1282-1293 (2014)
PUBMED 24280220
REMARK GeneRIF: cardiac telethonin is constitutively bis-phosphorylated
and suggest that such phosphorylation is critical for normal
telethonin function, which may include maintenance of transverse
tubule organization and intracellular Ca(2+) transients.
REFERENCE 2 (bases 1 to 997)
AUTHORS Heng AE, Ventadour S, Jarzaguet M, Pouch-Pelissier MN, Guezennec
CY, Bigard X, Attaix D and Taillandier D.
TITLE Coordinate expression of the 19S regulatory complex and evidence
for ubiquitin-dependent telethonin degradation in the unloaded
soleus muscle
JOURNAL Int J Biochem Cell Biol 40 (11), 2544-2552 (2008)
PUBMED 18565784
REMARK GeneRIF: data suggest that telethonin is a substrate of the
ubiquitin-proteasome system during soleus muscle atrophy.
REFERENCE 3 (bases 1 to 997)
AUTHORS Nakano N, Hori H, Abe M, Shibata H, Arimura T, Sasaoka T, Sawabe M,
Chida K, Arai T, Nakahara K, Kubo T, Sugimoto K, Katsuya T, Ogihara
T, Doi Y, Izumi T and Kimura A.
TITLE Interaction of BMP10 with Tcap may modulate the course of
hypertensive cardiac hypertrophy
JOURNAL Am J Physiol Heart Circ Physiol 293 (6), H3396-H3403 (2007)
PUBMED 17921333
REFERENCE 4 (bases 1 to 997)
AUTHORS Hayashi T, Arimura T, Itoh-Satoh M, Ueda K, Hohda S, Inagaki N,
Takahashi M, Hori H, Yasunami M, Nishi H, Koga Y, Nakamura H,
Matsuzaki M, Choi BY, Bae SW, You CW, Han KH, Park JE, Knoll R,
Hoshijima M, Chien KR and Kimura A.
TITLE Tcap gene mutations in hypertrophic cardiomyopathy and dilated
cardiomyopathy
JOURNAL J Am Coll Cardiol 44 (11), 2192-2201 (2004)
PUBMED 15582318
REFERENCE 5 (bases 1 to 997)
AUTHORS Knoll R, Hoshijima M, Hoffman HM, Person V, Lorenzen-Schmidt I,
Bang ML, Hayashi T, Shiga N, Yasukawa H, Schaper W, McKenna W,
Yokoyama M, Schork NJ, Omens JH, McCulloch AD, Kimura A, Gregorio
CC, Poller W, Schaper J, Schultheiss HP and Chien KR.
TITLE The cardiac mechanical stretch sensor machinery involves a Z disc
complex that is defective in a subset of human dilated
cardiomyopathy
JOURNAL Cell 111 (7), 943-955 (2002)
PUBMED 12507422
REFERENCE 6 (bases 1 to 997)
AUTHORS Itoh-Satoh M, Hayashi T, Nishi H, Koga Y, Arimura T, Koyanagi T,
Takahashi M, Hohda S, Ueda K, Nouchi T, Hiroe M, Marumo F, Imaizumi
T, Yasunami M and Kimura A.
TITLE Titin mutations as the molecular basis for dilated cardiomyopathy
JOURNAL Biochem Biophys Res Commun 291 (2), 385-393 (2002)
PUBMED 11846417
REFERENCE 7 (bases 1 to 997)
AUTHORS Furukawa T, Ono Y, Tsuchiya H, Katayama Y, Bang ML, Labeit D,
Labeit S, Inagaki N and Gregorio CC.
TITLE Specific interaction of the potassium channel beta-subunit minK
with the sarcomeric protein T-cap suggests a T-tubule-myofibril
linking system
JOURNAL J Mol Biol 313 (4), 775-784 (2001)
PUBMED 11697903
REFERENCE 8 (bases 1 to 997)
AUTHORS Gregorio CC, Trombitas K, Centner T, Kolmerer B, Stier G, Kunke K,
Suzuki K, Obermayr F, Herrmann B, Granzier H, Sorimachi H and
Labeit S.
TITLE The NH2 terminus of titin spans the Z-disc: its interaction with a
novel 19-kD ligand (T-cap) is required for sarcomeric integrity
JOURNAL J Cell Biol 143 (4), 1013-1027 (1998)
PUBMED 9817758
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
FQ216780.1 and BM384635.1.
On Sep 13, 2012 this sequence version replaced XM_001081394.3.
##Evidence-Data-START##
Transcript exon combination :: FQ216780.1, FQ215695.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMD00132297, SAMD00132302
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-778 FQ216780.1 1-778
779-997 BM384635.1 1-219 c
FEATURES Location/Qualifiers
source 1..997
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="Sprague-Dawley"
/db_xref="taxon:10116"
/chromosome="10"
/map="10q31"
gene 1..997
/gene="Tcap"
/note="titin-cap"
/db_xref="GeneID:688173"
/db_xref="RGD:1592387"
exon 1..135
/gene="Tcap"
/inference="alignment:Splign:2.1.0"
misc_feature 2..4
/gene="Tcap"
/note="upstream in-frame stop codon"
CDS 26..529
/gene="Tcap"
/note="titin cap protein"
/codon_start=1
/product="telethonin"
/protein_id="NP_001258206.1"
/db_xref="GeneID:688173"
/db_xref="RGD:1592387"
/translation="MATSELSCQVSEENQERREAFWAEWKDLTLSTRPEEGCSLHEED
TQRHETYHRQGQCQAVVQRSPWLVMRLGILGRGLQEYQLPYQRVLPLPIFTPTKVGAT
KEEREETPIQLRELLALETALGGQCVERQDVAEITKQLPPVVPVSKPGPLRRTLSRSM
SQEAQRG"
exon 136..979
/gene="Tcap"
/inference="alignment:Splign:2.1.0"
ORIGIN
1 atagcagagg gatcaagaag gaataatggc cacttcagag ctgagctgtc aagtgtctga
61 ggagaaccag gagcgcaggg aagccttctg ggccgagtgg aaagacctga ctctgtctac
121 ccggccggaa gagggatgct ccctgcatga ggaggataca cagaggcatg agacctacca
181 ccggcaggga cagtgtcagg ccgtggtaca gcgctcgcca tggctggtga tgcgcctggg
241 tatcctcggc cgtgggctgc aggaatacca gctgccgtac cagcgggtgc tgccgctacc
301 catcttcacc cctaccaagg tgggggccac caaggaggaa cgcgaggaga cccccattca
361 gctgcgggag ctgctggccc tggagacagc cctgggcggc cagtgcgtgg agcgccagga
421 cgtggctgag atcaccaagc agcttccccc ggtggtgcca gtcagcaaac ctgggcccct
481 gcggcgtacc ctgtctcggt ccatgtctca ggaagctcag agaggctgag atgactgcga
541 ccgatgcaga ctctgatgtg tctgccttgg gctgggcact tcctgcctag gacgatgggg
601 gagagctgct ggccaaggct gctttgtagt ttgcccagag gtgcgggcca tgggaggagg
661 gagccagagg ccaggatgcc taggtgtcct gggtccccac agggagggga acaaggatgg
721 tggacactag gagtggagag ctgagtaccc tcagccccag aagaagggac aagagattct
781 gttgagagcc agaggccccg tgagaggccc tggaacacgc ctgtgcggtt acagcgatgg
841 agtaggagaa ggaaggatgt agaatgctcc ggaaggatgc ttggagaccg gaaggagggg
901 gatgtaaaga gggtgaaagc agggcaggcc cccagcaccc tctgttagca ctgcaataaa
961 cgctcagcca tgtcccagga aaaaaaaaaa aaaaaaa
//