Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_001264516.3
FASTA Graphics
LOCUS NM_001264516 561 bp mRNA linear INV 04-DEC-2024 DEFINITION Caenorhabditis elegans Anaphase-promoting complex subunit CDC26 (cdc-26), partial mRNA. ACCESSION NM_001264516 VERSION NM_001264516.3 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 561) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 561) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 561) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (17-OCT-2024) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 561) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003279). On Apr 15, 2020 this sequence version replaced NM_001264516.2. COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..561 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="I" gene <1..>561 /gene="cdc-26" /locus_tag="CELE_B0511.9" /db_xref="GeneID:172958" /db_xref="WormBase:WBGene00015235" CDS 1..561 /gene="cdc-26" /locus_tag="CELE_B0511.9" /standard_name="B0511.9d" /note="Partially confirmed by transcript evidence" /codon_start=1 /product="Anaphase-promoting complex subunit CDC26" /protein_id="NP_001251445.1" /db_xref="GeneID:172958" /db_xref="WormBase:WBGene00015235" /translation="MSMLRRPLTQLELSVIVPKCEMMDIDEMEPMDQSEPPRGITRRN LRSADRKNRDVPGPSTGECTRTSIAPNRCEMSFTEVQTLTSARTPVAAPTLTLSTPVN PVSSAEMLRVMPPRVGRRPRASRSGDNDSPLLFNAYDTPQQGINDESPTPSDSPESPN AHLYATPGNPTSTSGGPSSNTRSHRH" ORIGIN 1 atgtcaatgt tacggcgtcc attaacacaa ttagaattgt ctgtgatcgt gccaaaatgc 61 gaaatgatgg atattgacga aatggagccg atggatcaga gtgagcctcc acgtggcata 121 actaggagaa atctcagatc ggcggataga aagaacagag acgttccagg accaagtacg 181 ggagagtgca cgcgtacttc cattgcaccg aatcgatgtg aaatgtcatt cactgaagtg 241 cagactttaa catctgctcg aactcctgtc gctgctccaa ctctaacact ttcgacgcca 301 gtcaaccctg tctcatcagc tgaaatgttg agagttatgc cacctcgtgt aggtcgacgt 361 ccacgagctt ctcgttctgg tgacaatgat tcgccactcc tcttcaacgc ttatgataca 421 ccacagcaag gaatcaatga cgaatctcca acaccctctg actctcccga atctcctaat 481 gctcatctct atgctactcc cggcaatcct acttcaactt ctggaggacc ttcttcaaat 541 acacgatctc acagacacta a //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on