Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_001261182.1
FASTA Graphics
LOCUS NM_001261182 1016 bp mRNA linear PRI 22-FEB-2022 DEFINITION Macaca mulatta Ras homolog, mTORC1 binding (RHEB), mRNA. ACCESSION NM_001261182 XM_001104682 VERSION NM_001261182.1 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. REFERENCE 1 (bases 1 to 1016) AUTHORS Zimin AV, Cornish AS, Maudhoo MD, Gibbs RM, Zhang X, Pandey S, Meehan DT, Wipfler K, Bosinger SE, Johnson ZP, Tharp GK, Marcais G, Roberts M, Ferguson B, Fox HS, Treangen T, Salzberg SL, Yorke JA and Norgren RB Jr. TITLE A new rhesus macaque assembly and annotation for next-generation sequencing analyses JOURNAL Biol Direct 9 (1), 20 (2014) PUBMED 25319552 REMARK Publication Status: Online-Only COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JV047844.1. On May 10, 2012 this sequence version replaced XM_001104682.2. ##Evidence-Data-START## Transcript exon combination :: JV047844.1, JU470465.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support SAMEA4688315, SAMEA4688316 [ECO:0000350] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1016 /organism="Macaca mulatta" /mol_type="mRNA" /db_xref="taxon:9544" /chromosome="3" /map="3" gene 1..1016 /gene="RHEB" /note="Ras homolog, mTORC1 binding" /db_xref="GeneID:715378" exon 1..103 /gene="RHEB" /inference="alignment:Splign:2.1.0" misc_feature 16..18 /gene="RHEB" /note="upstream in-frame stop codon" CDS 52..606 /gene="RHEB" /EC_number="3.6.5.2" /note="Ras homolog enriched in brain" /codon_start=1 /product="GTP-binding protein Rheb" /protein_id="NP_001248111.1" /db_xref="GeneID:715378" /translation="MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFT KLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGK LLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF RRIILEAEKMDGAASQGKSSCSVM" exon 104..175 /gene="RHEB" /inference="alignment:Splign:2.1.0" exon 176..243 /gene="RHEB" /inference="alignment:Splign:2.1.0" exon 244..326 /gene="RHEB" /inference="alignment:Splign:2.1.0" exon 327..383 /gene="RHEB" /inference="alignment:Splign:2.1.0" exon 384..431 /gene="RHEB" /inference="alignment:Splign:2.1.0" exon 432..513 /gene="RHEB" /inference="alignment:Splign:2.1.0" exon 514..1015 /gene="RHEB" /inference="alignment:Splign:2.1.0" ORIGIN 1 cgccgccgcc gcggttgatg tggttgggcc ggggctgagg aggccgccaa gatgccgcag 61 tccaagtccc ggaagatcgc gatcctgggc taccggtctg tggggaaatc ctcattgacg 121 attcaatttg ttgaaggcca atttgtggac tcctacgatc caaccataga aaacactttt 181 acaaagttga tcacagtaaa tggacaagaa tatcatcttc aacttgtaga cacagctggg 241 caagatgaat attctatctt tcctcagacc tactccatag atattaatgg ctatattctt 301 gtgtattctg ttacatcaat caaaagtttt gaagtgatta aagttatcca tgggaaatta 361 ttggatatgg tggggaaagt acaaatacct attatgttgg ttgggaataa gaaagacctg 421 catatggaaa gggtgatcag ttatgaagaa gggaaagctt tggcagaatc ttggaatgca 481 gcttttttgg aatcttctgc taaagaaaat cagactgctg ttgatgtttt tagaaggata 541 attttggagg cagaaaaaat ggatggggca gcttcacaag gcaagtcttc atgctcggtg 601 atgtgattct gctgcgaagc ccgaggacac tgggaatata ttctacctga agaagcaaac 661 tgcccgttct ccttgaagat caactatgct tcttttttct tctgttaacc tgaaagatat 721 catttgggtc agagctcccc tcccttcaga ttatgttaac tctgagtctg tccaaatgag 781 ttcacttcca ttttcaaatt ttaagcaatc atattttcaa tttatatatt gtatttctta 841 atattatgac caagaatttt atcggcatta atttttcagt gtagtttgtt gtttaaaata 901 atgtaatcat caaaatgatg catattgtta cactactatt aactaggctt caatatatca 961 gtgtttattt cattgtgtta atgtatactt gtaaataaaa tagctgcaaa cctcaa //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on