LOCUS NM_001036428 1392 bp mRNA linear PLN 20-OCT-2022
DEFINITION Arabidopsis thaliana NAD(P)-linked oxidoreductase superfamily
protein (ChlAKR), mRNA.
ACCESSION NM_001036428
VERSION NM_001036428.3
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 1392)
AUTHORS Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
Venter,J.C.
TITLE Sequence and analysis of chromosome 2 of the plant Arabidopsis
thaliana
JOURNAL Nature 402 (6763), 761-768 (1999)
PUBMED 10617197
REFERENCE 2 (bases 1 to 1392)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 1392)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 1392)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
This record is derived from an annotated genomic sequence
(NC_003071).
On Sep 12, 2016 this sequence version replaced NM_001036428.2.
FEATURES Location/Qualifiers
source 1..1392
/organism="Arabidopsis thaliana"
/mol_type="mRNA"
/db_xref="taxon:3702"
/chromosome="2"
/ecotype="Columbia"
gene 1..1392
/gene="ChlAKR"
/locus_tag="AT2G37770"
/gene_synonym="AKR4C9; Aldo-keto reductase family 4 member
C9; Chloroplastic aldo-keto reductase; T8P21.32"
/note="Encodes an NADPH-dependent aldo-keto reductase that
can act on a wide variety of substrates in vitro including
saturated and unsaturated aldehydes, steroids, and sugars.
GFP-tagged AKR4C9 localizes to the chloroplast where it
may play a role in detoxifying reactive carbonyl compounds
that threaten to impair the photosynthetic process.
Transcript levels for this gene are up-regulated in
response to cold, salt, and drought stress."
/db_xref="Araport:AT2G37770"
/db_xref="GeneID:818354"
/db_xref="TAIR:AT2G37770"
CDS 123..1070
/gene="ChlAKR"
/locus_tag="AT2G37770"
/gene_synonym="AKR4C9; Aldo-keto reductase family 4 member
C9; Chloroplastic aldo-keto reductase; T8P21.32"
/inference="Similar to RNA sequence,
EST:INSD:BP784080.1,INSD:AU228041.1,INSD:CF773503.1,
INSD:BE038607.1,INSD:EG501583.1,INSD:BX837456.1,
INSD:BP631536.1,INSD:BE525225.1,INSD:EG501582.1,
INSD:BP791465.1,INSD:EG520969.1,INSD:AV557675.1,
INSD:AV562864.1,INSD:CB260213.1,INSD:EG520967.1,
INSD:AU237027.1"
/inference="similar to RNA sequence,
mRNA:INSD:DQ837654.1,INSD:BT004098.1,INSD:BX820531.1"
/note="NAD(P)-linked oxidoreductase superfamily protein;
FUNCTIONS IN: oxidoreductase activity; INVOLVED IN:
oxidation reduction; EXPRESSED IN: 12 plant structures;
EXPRESSED DURING: LP.04 four leaves visible, 4 anthesis,
petal differentiation and expansion stage; CONTAINS
InterPro DOMAIN/s: Aldo/keto reductase
(InterPro:IPR001395), Aldo/keto reductase subgroup
(InterPro:IPR020471), Aldo/keto reductase, conserved site
(InterPro:IPR018170); BEST Arabidopsis thaliana protein
match is: NAD(P)-linked oxidoreductase superfamily protein
(TAIR:AT2G37790.1); Has 35333 Blast hits to 34131 proteins
in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
974; Fungi - 991; Plants - 531; Viruses - 0; Other
Eukaryotes - 9610 (source: NCBI BLink)."
/codon_start=1
/product="NAD(P)-linked oxidoreductase superfamily
protein"
/protein_id="NP_001031505.1"
/db_xref="Araport:AT2G37770"
/db_xref="GeneID:818354"
/db_xref="TAIR:AT2G37770"
/translation="MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYR
HIDCAQIYGNEKEIGAVLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALNRTLKD
LQLEYVDLYLIHWPARIKKGSVGIKPENLLPVDIPSTWKAMEALYDSGKARAIGVSNF
STKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVHLSAYSPLGSPGTTWLK
SDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKSTNEGRIKENFNVFDWSIPD
YMFAKFAEIEQARLVTGSFLVHETLSPYKSIEELWDGEI"
ORIGIN
1 cagaaagaag aaatcaattt ggccacgaat ctcccgcctc tgtcgctctc tcacttcttc
61 tcacccttta atagctagtg ccgagtgcag tgtgcgttga acaaccacca ccacatctga
121 taatggcaaa tgcgatcaca tttttcaagc tcaacaccgg cgctaagttc ccttcggtgg
181 gtcttggaac atggcaagct tctcctggcc tcgtcggtga tgcagtcgcc gcggctgtta
241 agattggcta tcgtcacatt gattgtgctc agatctatgg caacgaaaaa gagattgggg
301 cagttctgaa aaaattgttt gaagacagag tagtgaaacg cgaggatttg ttcatcacct
361 ccaaactctg gtgtactgat catgaccctc aagatgtccc ggaggcattg aacagaactc
421 tcaaggatct gcagcttgaa tacgtcgatc tttatctgat acactggcct gcacggataa
481 agaaaggttc tgttggaata aagccagaga accttttgcc tgtagatatt cctagtacat
541 ggaaagcgat ggaagcacta tacgattcgg gcaaggcacg agccataggt gtaagcaatt
601 tctctaccaa gaaactagct gatctcttgg agttagctcg tgttcctcct gctgttaatc
661 aggtcgaatg tcatccttct tggcgacaaa ctaagctaca agaattctgc aaatccaaag
721 gggttcacct aagtgcatac tcgccattag gttctccagg gacaacatgg ctgaagagcg
781 atgttttgaa gaacccgata ctgaatatgg ttgcggaaaa actcggaaag agtcctgcgc
841 aagtcgccct tcgttgggga ctccaaatgg gtcacagtgt gcttcccaag agtacaaatg
901 aaggaaggat caaagagaac tttaatgttt tcgactggtc aatacccgat tacatgttcg
961 ctaagtttgc tgagattgaa caggctaggt tagtcactgg ttccttcctt gttcatgaga
1021 cactaagccc ttacaagtct attgaagaat tatgggatgg cgagatatga tttttagctg
1081 atctaaataa tgggagctag gtttctctct ctgatgaact agtcagtatc tttttttttt
1141 taatgaatgt taaatttatt caaccagaaa aaaccttctt tacattatat gcaactttga
1201 gtagaacatg aaactgtatt gtgcttgtca gtttcttatg gatgttattt atttacaaag
1261 ttttttttta tagaaaaagg atctatttat acaattgcaa tgtattatag tcatttcaaa
1321 tcgaaaatgt gttgtttgca tatgtctgtg aacataccaa tattcacatt gcattagagc
1381 taaaaagtcc ga
//