U.S. flag

An official website of the United States government

Arabidopsis thaliana NAD(P)-linked oxidoreductase superfamily protein (ChlAKR), mRNA

NCBI Reference Sequence: NM_001036428.3

FASTA Graphics 

LOCUS       NM_001036428            1392 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana NAD(P)-linked oxidoreductase superfamily
            protein (ChlAKR), mRNA.
ACCESSION   NM_001036428
VERSION     NM_001036428.3
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1392)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 1392)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1392)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1392)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003071).
            
            On Sep 12, 2016 this sequence version replaced NM_001036428.2.
FEATURES             Location/Qualifiers
     source          1..1392
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gene            1..1392
                     /gene="ChlAKR"
                     /locus_tag="AT2G37770"
                     /gene_synonym="AKR4C9; Aldo-keto reductase family 4 member
                     C9; Chloroplastic aldo-keto reductase; T8P21.32"
                     /note="Encodes an NADPH-dependent aldo-keto reductase that
                     can act on a wide variety of substrates in vitro including
                     saturated and unsaturated aldehydes, steroids, and sugars.
                     GFP-tagged AKR4C9 localizes to the chloroplast where it
                     may play a role in detoxifying reactive carbonyl compounds
                     that threaten to impair the photosynthetic process.
                     Transcript levels for this gene are up-regulated in
                     response to cold, salt, and drought stress."
                     /db_xref="Araport:AT2G37770"
                     /db_xref="GeneID:818354"
                     /db_xref="TAIR:AT2G37770"
     CDS             123..1070
                     /gene="ChlAKR"
                     /locus_tag="AT2G37770"
                     /gene_synonym="AKR4C9; Aldo-keto reductase family 4 member
                     C9; Chloroplastic aldo-keto reductase; T8P21.32"
                     /inference="Similar to RNA sequence,
                     EST:INSD:BP784080.1,INSD:AU228041.1,INSD:CF773503.1,
                     INSD:BE038607.1,INSD:EG501583.1,INSD:BX837456.1,
                     INSD:BP631536.1,INSD:BE525225.1,INSD:EG501582.1,
                     INSD:BP791465.1,INSD:EG520969.1,INSD:AV557675.1,
                     INSD:AV562864.1,INSD:CB260213.1,INSD:EG520967.1,
                     INSD:AU237027.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:DQ837654.1,INSD:BT004098.1,INSD:BX820531.1"
                     /note="NAD(P)-linked oxidoreductase superfamily protein;
                     FUNCTIONS IN: oxidoreductase activity; INVOLVED IN:
                     oxidation reduction; EXPRESSED IN: 12 plant structures;
                     EXPRESSED DURING: LP.04 four leaves visible, 4 anthesis,
                     petal differentiation and expansion stage; CONTAINS
                     InterPro DOMAIN/s: Aldo/keto reductase
                     (InterPro:IPR001395), Aldo/keto reductase subgroup
                     (InterPro:IPR020471), Aldo/keto reductase, conserved site
                     (InterPro:IPR018170); BEST Arabidopsis thaliana protein
                     match is: NAD(P)-linked oxidoreductase superfamily protein
                     (TAIR:AT2G37790.1); Has 35333 Blast hits to 34131 proteins
                     in 2444 species: Archae - 798; Bacteria - 22429; Metazoa -
                     974; Fungi - 991; Plants - 531; Viruses - 0; Other
                     Eukaryotes - 9610 (source: NCBI BLink)."
                     /codon_start=1
                     /product="NAD(P)-linked oxidoreductase superfamily
                     protein"
                     /protein_id="NP_001031505.1"
                     /db_xref="Araport:AT2G37770"
                     /db_xref="GeneID:818354"
                     /db_xref="TAIR:AT2G37770"
                     /translation="MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYR
                     HIDCAQIYGNEKEIGAVLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALNRTLKD
                     LQLEYVDLYLIHWPARIKKGSVGIKPENLLPVDIPSTWKAMEALYDSGKARAIGVSNF
                     STKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVHLSAYSPLGSPGTTWLK
                     SDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKSTNEGRIKENFNVFDWSIPD
                     YMFAKFAEIEQARLVTGSFLVHETLSPYKSIEELWDGEI"
ORIGIN      
        1 cagaaagaag aaatcaattt ggccacgaat ctcccgcctc tgtcgctctc tcacttcttc
       61 tcacccttta atagctagtg ccgagtgcag tgtgcgttga acaaccacca ccacatctga
      121 taatggcaaa tgcgatcaca tttttcaagc tcaacaccgg cgctaagttc ccttcggtgg
      181 gtcttggaac atggcaagct tctcctggcc tcgtcggtga tgcagtcgcc gcggctgtta
      241 agattggcta tcgtcacatt gattgtgctc agatctatgg caacgaaaaa gagattgggg
      301 cagttctgaa aaaattgttt gaagacagag tagtgaaacg cgaggatttg ttcatcacct
      361 ccaaactctg gtgtactgat catgaccctc aagatgtccc ggaggcattg aacagaactc
      421 tcaaggatct gcagcttgaa tacgtcgatc tttatctgat acactggcct gcacggataa
      481 agaaaggttc tgttggaata aagccagaga accttttgcc tgtagatatt cctagtacat
      541 ggaaagcgat ggaagcacta tacgattcgg gcaaggcacg agccataggt gtaagcaatt
      601 tctctaccaa gaaactagct gatctcttgg agttagctcg tgttcctcct gctgttaatc
      661 aggtcgaatg tcatccttct tggcgacaaa ctaagctaca agaattctgc aaatccaaag
      721 gggttcacct aagtgcatac tcgccattag gttctccagg gacaacatgg ctgaagagcg
      781 atgttttgaa gaacccgata ctgaatatgg ttgcggaaaa actcggaaag agtcctgcgc
      841 aagtcgccct tcgttgggga ctccaaatgg gtcacagtgt gcttcccaag agtacaaatg
      901 aaggaaggat caaagagaac tttaatgttt tcgactggtc aatacccgat tacatgttcg
      961 ctaagtttgc tgagattgaa caggctaggt tagtcactgg ttccttcctt gttcatgaga
     1021 cactaagccc ttacaagtct attgaagaat tatgggatgg cgagatatga tttttagctg
     1081 atctaaataa tgggagctag gtttctctct ctgatgaact agtcagtatc tttttttttt
     1141 taatgaatgt taaatttatt caaccagaaa aaaccttctt tacattatat gcaactttga
     1201 gtagaacatg aaactgtatt gtgcttgtca gtttcttatg gatgttattt atttacaaag
     1261 ttttttttta tagaaaaagg atctatttat acaattgcaa tgtattatag tcatttcaaa
     1321 tcgaaaatgt gttgtttgca tatgtctgtg aacataccaa tattcacatt gcattagagc
     1381 taaaaagtcc ga
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq alternative splicing
    See the other reference mRNA sequence splice variant for the ChlAKR gene (NM_129333.3).
  • RefSeq protein product
    See the reference protein sequence for NAD(P)-linked oxidoreductase superfamily protein (NP_001031505.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.