U.S. flag

An official website of the United States government

Arabidopsis thaliana chromosome 2, partial sequence

NCBI Reference Sequence: NC_003071.7

FASTA Graphics 

LOCUS       NC_003071                961 bp    DNA     linear   CON 10-APR-2023
DEFINITION  Arabidopsis thaliana chromosome 2, partial sequence.
ACCESSION   NC_003071 REGION: 16243215..16244175
VERSION     NC_003071.7
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
            Assembly: GCF_000001735.4
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 961)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 961)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 961)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 961)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            The reference sequence is identical to CP002685.
            
            On Jun 19, 2009 this sequence version replaced NC_003071.6.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: TAIR and Araport
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..961
                     /organism="Arabidopsis thaliana"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gene            1..961
                     /locus_tag="AT2G38900"
                     /gene_synonym="T7F6.7; T7F6_7"
                     /note="Predicted to encode a PR (pathogenesis-related)
                     peptide that belongs to the PR-6 proteinase inhibitor
                     family. Six putative PR-6-type protein encoding genes are
                     found in Arabidopsis: At2g38900, At2g38870, At5g43570,
                     At5g43580, At3g50020 and At3g46860."
                     /db_xref="Araport:AT2G38900"
                     /db_xref="GeneID:818474"
                     /db_xref="TAIR:AT2G38900"
     mRNA            join(1..145,486..961)
                     /locus_tag="AT2G38900"
                     /gene_synonym="T7F6.7; T7F6_7"
                     /product="Serine protease inhibitor, potato inhibitor
                     I-type family protein"
                     /transcript_id="NM_001202778.2"
                     /db_xref="GeneID:818474"
                     /db_xref="TAIR:AT2G38900"
                     /db_xref="Araport:AT2G38900"
     mRNA            join(1..100,486..961)
                     /locus_tag="AT2G38900"
                     /gene_synonym="T7F6.7; T7F6_7"
                     /product="Serine protease inhibitor, potato inhibitor
                     I-type family protein"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AM111191.1,INSD:DR199377.1,INSD:ES210303.1,
                     INSD:ES050588.1,INSD:ES058632.1,INSD:DR199376.1,
                     INSD:DR199374.1,INSD:BP594956.1,INSD:DR199378.1,
                     INSD:DR199375.1,INSD:ES156263.1,INSD:EL985526.1,
                     INSD:DR199380.1,INSD:ES205193.1,INSD:ES136508.1,
                     INSD:AU227561.1,INSD:ES173805.1,INSD:DR199379.1,
                     INSD:CK120076.1,INSD:ES096113.1,INSD:ES203158.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY085760.1,INSD:BT004263.1,INSD:BT005526.1"
                     /transcript_id="NM_129447.5"
                     /db_xref="GeneID:818474"
                     /db_xref="TAIR:AT2G38900"
                     /db_xref="Araport:AT2G38900"
     CDS             join(73..145,486..679)
                     /locus_tag="AT2G38900"
                     /gene_synonym="T7F6.7; T7F6_7"
                     /note="Serine protease inhibitor, potato inhibitor I-type
                     family protein; FUNCTIONS IN: serine-type endopeptidase
                     inhibitor activity; INVOLVED IN: response to wounding,
                     defense response; LOCATED IN: endomembrane system;
                     EXPRESSED IN: embryo; EXPRESSED DURING: C globular stage;
                     CONTAINS InterPro DOMAIN/s: Proteinase inhibitor I13,
                     potato inhibitor I (InterPro:IPR000864); BEST Arabidopsis
                     thaliana protein match is: Serine protease inhibitor,
                     potato inhibitor I-type family protein
                     (TAIR:AT2G38870.1)."
                     /codon_start=1
                     /product="Serine protease inhibitor, potato inhibitor
                     I-type family protein"
                     /protein_id="NP_001189707.1"
                     /db_xref="Araport:AT2G38900"
                     /db_xref="GeneID:818474"
                     /db_xref="TAIR:AT2G38900"
                     /translation="MATEWCSYIGSSFILNFYFSFFDIGKNSWPELLGTNGDYAASVI
                     KGENSSLNVVVVSDGNYVTEDLSCYRVRVWVDEIRIVVRNPTAG"
     CDS             join(73..100,486..679)
                     /locus_tag="AT2G38900"
                     /gene_synonym="T7F6.7; T7F6_7"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AM111191.1,INSD:DR199377.1,INSD:ES210303.1,
                     INSD:ES050588.1,INSD:ES058632.1,INSD:DR199376.1,
                     INSD:DR199374.1,INSD:BP594956.1,INSD:DR199378.1,
                     INSD:DR199375.1,INSD:ES156263.1,INSD:EL985526.1,
                     INSD:DR199380.1,INSD:ES205193.1,INSD:ES136508.1,
                     INSD:AU227561.1,INSD:ES173805.1,INSD:DR199379.1,
                     INSD:CK120076.1,INSD:ES096113.1,INSD:ES203158.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY085760.1,INSD:BT004263.1,INSD:BT005526.1"
                     /note="Serine protease inhibitor, potato inhibitor I-type
                     family protein; FUNCTIONS IN: serine-type endopeptidase
                     inhibitor activity; INVOLVED IN: response to wounding,
                     defense response; EXPRESSED IN: embryo; EXPRESSED DURING:
                     C globular stage; CONTAINS InterPro DOMAIN/s: Proteinase
                     inhibitor I13, potato inhibitor I (InterPro:IPR000864);
                     BEST Arabidopsis thaliana protein match is: Serine
                     protease inhibitor, potato inhibitor I-type family protein
                     (TAIR:AT2G38870.1); Has 277 Blast hits to 277 proteins in
                     50 species: Archae - 0; Bacteria - 2; Metazoa - 0; Fungi -
                     0; Plants - 269; Viruses - 0; Other Eukaryotes - 6
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="Serine protease inhibitor, potato inhibitor
                     I-type family protein"
                     /protein_id="NP_030438.1"
                     /db_xref="Araport:AT2G38900"
                     /db_xref="GeneID:818474"
                     /db_xref="TAIR:AT2G38900"
                     /translation="MATEWCSYIGKNSWPELLGTNGDYAASVIKGENSSLNVVVVSDG
                     NYVTEDLSCYRVRVWVDEIRIVVRNPTAG"
     gene            complement(847..>961)
                     /locus_tag="AT2G38905"
                     /db_xref="Araport:AT2G38905"
                     /db_xref="GeneID:818475"
                     /db_xref="TAIR:AT2G38905"
     mRNA            complement(847..>961)
                     /locus_tag="AT2G38905"
                     /product="Low temperature and salt responsive protein
                     family"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV824849.1,INSD:DR351594.1,INSD:AV788112.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:AY052231.1,INSD:AY060504.1"
                     /transcript_id="NM_129448.3"
                     /db_xref="GeneID:818475"
                     /db_xref="TAIR:AT2G38905"
                     /db_xref="Araport:AT2G38905"
ORIGIN      
        1 ctcaaattcc tgaggacaat catagcaaac aatcacatca tcgcaatata cataaacaaa
       61 agaggaagaa aaatggcaac cgagtggtgt agttatattg gttcgtcttt catcctcaat
      121 ttctactttt cattctttga tattggtacc gccctttatc gattttcttt aatcttttct
      181 cttctcgctc acgtcaaatc gtttactatt atttaattct catgtgtcag tttcacatag
      241 cacattcttg aggaaattaa ttataatttg gagcatgcat tgtttatcga ttgacacaga
      301 tttatgtttc atctattgtt tgaataacaa tggattacac aacaaatccc caatatatga
      361 tatttggaga gccatatagt attagtaggg atatatagtt tgattccata ataaccgttg
      421 gacctactgt tttaccaaat gcaaatgatt taccaatctg atgtggttga tttgaccaca
      481 cacagggaag aactcatggc cggagctttt aggaacaaat ggagactatg cggcttcggt
      541 gataaaagga gagaactcga gcctcaacgt tgtcgtggtt tcggatggaa attatgtgac
      601 tgaagacctc agttgctacc gcgttagggt ttgggttgac gaaatccgta tcgttgtcag
      661 aaacccaacc gccggctaga catgtatatg gaccaccatt atgctatagc catgtaggcg
      721 ccttactatg aataaatgaa actatatata atgcatgcat agttggttgg ttggtcataa
      781 tgtaacatct attgtttgct tgaatgattc tggtgtccga tcatataacg catttgaatg
      841 gatgatgtgg tgtatatttt ggcagccctg gtgatttagg aactaagcaa aaatagtatt
      901 ttatttagcg aaaacgcaag agttgtttat tacaaagagc gataagaaaa gaacaacaaa
      961 g
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown



Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.