LOCUS NC_003071 961 bp DNA linear CON 10-APR-2023
DEFINITION Arabidopsis thaliana chromosome 2, partial sequence.
ACCESSION NC_003071 REGION: 16243215..16244175
VERSION NC_003071.7
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
Assembly: GCF_000001735.4
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 961)
AUTHORS Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
Venter,J.C.
TITLE Sequence and analysis of chromosome 2 of the plant Arabidopsis
thaliana
JOURNAL Nature 402 (6763), 761-768 (1999)
PUBMED 10617197
REFERENCE 2 (bases 1 to 961)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 961)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 961)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
The reference sequence is identical to CP002685.
On Jun 19, 2009 this sequence version replaced NC_003071.6.
##Genome-Annotation-Data-START##
Annotation Provider :: TAIR and Araport
Annotation Status :: Full annotation
Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..961
/organism="Arabidopsis thaliana"
/mol_type="genomic DNA"
/db_xref="taxon:3702"
/chromosome="2"
/ecotype="Columbia"
gene 1..961
/locus_tag="AT2G38900"
/gene_synonym="T7F6.7; T7F6_7"
/note="Predicted to encode a PR (pathogenesis-related)
peptide that belongs to the PR-6 proteinase inhibitor
family. Six putative PR-6-type protein encoding genes are
found in Arabidopsis: At2g38900, At2g38870, At5g43570,
At5g43580, At3g50020 and At3g46860."
/db_xref="Araport:AT2G38900"
/db_xref="GeneID:818474"
/db_xref="TAIR:AT2G38900"
mRNA join(1..145,486..961)
/locus_tag="AT2G38900"
/gene_synonym="T7F6.7; T7F6_7"
/product="Serine protease inhibitor, potato inhibitor
I-type family protein"
/transcript_id="NM_001202778.2"
/db_xref="GeneID:818474"
/db_xref="TAIR:AT2G38900"
/db_xref="Araport:AT2G38900"
mRNA join(1..100,486..961)
/locus_tag="AT2G38900"
/gene_synonym="T7F6.7; T7F6_7"
/product="Serine protease inhibitor, potato inhibitor
I-type family protein"
/inference="Similar to RNA sequence,
EST:INSD:AM111191.1,INSD:DR199377.1,INSD:ES210303.1,
INSD:ES050588.1,INSD:ES058632.1,INSD:DR199376.1,
INSD:DR199374.1,INSD:BP594956.1,INSD:DR199378.1,
INSD:DR199375.1,INSD:ES156263.1,INSD:EL985526.1,
INSD:DR199380.1,INSD:ES205193.1,INSD:ES136508.1,
INSD:AU227561.1,INSD:ES173805.1,INSD:DR199379.1,
INSD:CK120076.1,INSD:ES096113.1,INSD:ES203158.1"
/inference="similar to RNA sequence,
mRNA:INSD:AY085760.1,INSD:BT004263.1,INSD:BT005526.1"
/transcript_id="NM_129447.5"
/db_xref="GeneID:818474"
/db_xref="TAIR:AT2G38900"
/db_xref="Araport:AT2G38900"
CDS join(73..145,486..679)
/locus_tag="AT2G38900"
/gene_synonym="T7F6.7; T7F6_7"
/note="Serine protease inhibitor, potato inhibitor I-type
family protein; FUNCTIONS IN: serine-type endopeptidase
inhibitor activity; INVOLVED IN: response to wounding,
defense response; LOCATED IN: endomembrane system;
EXPRESSED IN: embryo; EXPRESSED DURING: C globular stage;
CONTAINS InterPro DOMAIN/s: Proteinase inhibitor I13,
potato inhibitor I (InterPro:IPR000864); BEST Arabidopsis
thaliana protein match is: Serine protease inhibitor,
potato inhibitor I-type family protein
(TAIR:AT2G38870.1)."
/codon_start=1
/product="Serine protease inhibitor, potato inhibitor
I-type family protein"
/protein_id="NP_001189707.1"
/db_xref="Araport:AT2G38900"
/db_xref="GeneID:818474"
/db_xref="TAIR:AT2G38900"
/translation="MATEWCSYIGSSFILNFYFSFFDIGKNSWPELLGTNGDYAASVI
KGENSSLNVVVVSDGNYVTEDLSCYRVRVWVDEIRIVVRNPTAG"
CDS join(73..100,486..679)
/locus_tag="AT2G38900"
/gene_synonym="T7F6.7; T7F6_7"
/inference="Similar to RNA sequence,
EST:INSD:AM111191.1,INSD:DR199377.1,INSD:ES210303.1,
INSD:ES050588.1,INSD:ES058632.1,INSD:DR199376.1,
INSD:DR199374.1,INSD:BP594956.1,INSD:DR199378.1,
INSD:DR199375.1,INSD:ES156263.1,INSD:EL985526.1,
INSD:DR199380.1,INSD:ES205193.1,INSD:ES136508.1,
INSD:AU227561.1,INSD:ES173805.1,INSD:DR199379.1,
INSD:CK120076.1,INSD:ES096113.1,INSD:ES203158.1"
/inference="similar to RNA sequence,
mRNA:INSD:AY085760.1,INSD:BT004263.1,INSD:BT005526.1"
/note="Serine protease inhibitor, potato inhibitor I-type
family protein; FUNCTIONS IN: serine-type endopeptidase
inhibitor activity; INVOLVED IN: response to wounding,
defense response; EXPRESSED IN: embryo; EXPRESSED DURING:
C globular stage; CONTAINS InterPro DOMAIN/s: Proteinase
inhibitor I13, potato inhibitor I (InterPro:IPR000864);
BEST Arabidopsis thaliana protein match is: Serine
protease inhibitor, potato inhibitor I-type family protein
(TAIR:AT2G38870.1); Has 277 Blast hits to 277 proteins in
50 species: Archae - 0; Bacteria - 2; Metazoa - 0; Fungi -
0; Plants - 269; Viruses - 0; Other Eukaryotes - 6
(source: NCBI BLink)."
/codon_start=1
/product="Serine protease inhibitor, potato inhibitor
I-type family protein"
/protein_id="NP_030438.1"
/db_xref="Araport:AT2G38900"
/db_xref="GeneID:818474"
/db_xref="TAIR:AT2G38900"
/translation="MATEWCSYIGKNSWPELLGTNGDYAASVIKGENSSLNVVVVSDG
NYVTEDLSCYRVRVWVDEIRIVVRNPTAG"
gene complement(847..>961)
/locus_tag="AT2G38905"
/db_xref="Araport:AT2G38905"
/db_xref="GeneID:818475"
/db_xref="TAIR:AT2G38905"
mRNA complement(847..>961)
/locus_tag="AT2G38905"
/product="Low temperature and salt responsive protein
family"
/inference="Similar to RNA sequence,
EST:INSD:AV824849.1,INSD:DR351594.1,INSD:AV788112.1"
/inference="similar to RNA sequence,
mRNA:INSD:AY052231.1,INSD:AY060504.1"
/transcript_id="NM_129448.3"
/db_xref="GeneID:818475"
/db_xref="TAIR:AT2G38905"
/db_xref="Araport:AT2G38905"
ORIGIN
1 ctcaaattcc tgaggacaat catagcaaac aatcacatca tcgcaatata cataaacaaa
61 agaggaagaa aaatggcaac cgagtggtgt agttatattg gttcgtcttt catcctcaat
121 ttctactttt cattctttga tattggtacc gccctttatc gattttcttt aatcttttct
181 cttctcgctc acgtcaaatc gtttactatt atttaattct catgtgtcag tttcacatag
241 cacattcttg aggaaattaa ttataatttg gagcatgcat tgtttatcga ttgacacaga
301 tttatgtttc atctattgtt tgaataacaa tggattacac aacaaatccc caatatatga
361 tatttggaga gccatatagt attagtaggg atatatagtt tgattccata ataaccgttg
421 gacctactgt tttaccaaat gcaaatgatt taccaatctg atgtggttga tttgaccaca
481 cacagggaag aactcatggc cggagctttt aggaacaaat ggagactatg cggcttcggt
541 gataaaagga gagaactcga gcctcaacgt tgtcgtggtt tcggatggaa attatgtgac
601 tgaagacctc agttgctacc gcgttagggt ttgggttgac gaaatccgta tcgttgtcag
661 aaacccaacc gccggctaga catgtatatg gaccaccatt atgctatagc catgtaggcg
721 ccttactatg aataaatgaa actatatata atgcatgcat agttggttgg ttggtcataa
781 tgtaacatct attgtttgct tgaatgattc tggtgtccga tcatataacg catttgaatg
841 gatgatgtgg tgtatatttt ggcagccctg gtgatttagg aactaagcaa aaatagtatt
901 ttatttagcg aaaacgcaag agttgtttat tacaaagagc gataagaaaa gaacaacaaa
961 g
//